Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GS20

Protein Details
Accession L2GS20   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
81-105IDSPSICNKKICKKTKKIKKTKKNVHydrophilic
NLS Segment(s)
PositionSequence
93-104KKTKKIKKTKKN
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
Amino Acid Sequences METWIDKMKSGEKITSIKKEVEEFKRKCALEKAQAKISATLKKQVQVTMPNYERRHCVVVQKNTMPVSFGETNAKETKKQIDSPSICNKKICKKTKKIKKTKKNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.47
4 0.43
5 0.42
6 0.45
7 0.49
8 0.51
9 0.55
10 0.49
11 0.53
12 0.58
13 0.56
14 0.54
15 0.53
16 0.5
17 0.49
18 0.55
19 0.53
20 0.51
21 0.53
22 0.5
23 0.47
24 0.44
25 0.41
26 0.34
27 0.36
28 0.31
29 0.32
30 0.33
31 0.3
32 0.29
33 0.29
34 0.3
35 0.32
36 0.34
37 0.38
38 0.38
39 0.37
40 0.36
41 0.32
42 0.32
43 0.26
44 0.31
45 0.32
46 0.38
47 0.43
48 0.42
49 0.43
50 0.4
51 0.39
52 0.32
53 0.23
54 0.23
55 0.18
56 0.18
57 0.2
58 0.19
59 0.23
60 0.27
61 0.28
62 0.23
63 0.25
64 0.32
65 0.31
66 0.36
67 0.37
68 0.43
69 0.45
70 0.51
71 0.6
72 0.59
73 0.56
74 0.56
75 0.58
76 0.58
77 0.65
78 0.68
79 0.68
80 0.72
81 0.81
82 0.88
83 0.92
84 0.93
85 0.94