Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5AH99

Protein Details
Accession Q5AH99    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-38AIFQLKQQRDKLKQYQKRLNTIIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005024  Snf7_fam  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043231  C:intracellular membrane-bounded organelle  
GO:0071285  P:cellular response to lithium ion  
GO:0071467  P:cellular response to pH  
GO:0030447  P:filamentous growth  
GO:0036178  P:filamentous growth of a population of unicellular organisms in response to neutral pH  
GO:0036177  P:filamentous growth of a population of unicellular organisms in response to pH  
GO:0043328  P:protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway  
KEGG cal:CAALFM_C203310CA  -  
Pfam View protein in Pfam  
PF03357  Snf7  
Amino Acid Sequences MGQQPSTPKITAQDRAIFQLKQQRDKLKQYQKRLNTIIEKQTELAKKAVLNKQPEKAKFYLRSKKQQESVISTTFDQLNNLEKLIGTIEFKLIEKDVVYGLQQGNKVLQKLNNEMQVEKIDALIDQLEDEKLKVDEVSELLGGVDQLNRSEEDEVDKEFQTLQEEIHGKIKQVTEEEEEESNLPKVPNTKPMPEAPSNEIEEHTPQKETKHEPIAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.5
4 0.43
5 0.41
6 0.44
7 0.45
8 0.46
9 0.52
10 0.56
11 0.59
12 0.69
13 0.75
14 0.77
15 0.79
16 0.81
17 0.84
18 0.82
19 0.83
20 0.77
21 0.75
22 0.71
23 0.7
24 0.67
25 0.6
26 0.54
27 0.45
28 0.48
29 0.44
30 0.38
31 0.32
32 0.26
33 0.26
34 0.33
35 0.39
36 0.38
37 0.43
38 0.46
39 0.52
40 0.58
41 0.59
42 0.56
43 0.52
44 0.54
45 0.55
46 0.6
47 0.62
48 0.62
49 0.7
50 0.71
51 0.76
52 0.72
53 0.7
54 0.64
55 0.62
56 0.58
57 0.5
58 0.45
59 0.38
60 0.34
61 0.29
62 0.25
63 0.17
64 0.14
65 0.16
66 0.14
67 0.14
68 0.12
69 0.11
70 0.11
71 0.11
72 0.11
73 0.07
74 0.07
75 0.07
76 0.08
77 0.08
78 0.09
79 0.08
80 0.08
81 0.07
82 0.07
83 0.07
84 0.06
85 0.06
86 0.08
87 0.09
88 0.11
89 0.11
90 0.11
91 0.13
92 0.14
93 0.15
94 0.14
95 0.16
96 0.16
97 0.2
98 0.23
99 0.25
100 0.24
101 0.24
102 0.23
103 0.22
104 0.2
105 0.15
106 0.12
107 0.07
108 0.07
109 0.07
110 0.06
111 0.05
112 0.04
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.07
124 0.07
125 0.06
126 0.06
127 0.06
128 0.06
129 0.05
130 0.05
131 0.06
132 0.05
133 0.06
134 0.07
135 0.07
136 0.09
137 0.09
138 0.09
139 0.13
140 0.14
141 0.16
142 0.17
143 0.17
144 0.16
145 0.15
146 0.16
147 0.15
148 0.14
149 0.12
150 0.15
151 0.17
152 0.18
153 0.24
154 0.24
155 0.22
156 0.26
157 0.27
158 0.23
159 0.24
160 0.26
161 0.24
162 0.25
163 0.27
164 0.24
165 0.23
166 0.22
167 0.21
168 0.19
169 0.17
170 0.15
171 0.14
172 0.18
173 0.2
174 0.29
175 0.32
176 0.36
177 0.39
178 0.44
179 0.5
180 0.5
181 0.52
182 0.47
183 0.48
184 0.46
185 0.43
186 0.38
187 0.33
188 0.33
189 0.33
190 0.3
191 0.28
192 0.27
193 0.29
194 0.36
195 0.41
196 0.44