Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GR09

Protein Details
Accession L2GR09    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
62-85AMTLKSKKRLSQVKKRRSESKNIVHydrophilic
NLS Segment(s)
PositionSequence
68-78KKRLSQVKKRR
Subcellular Location(s) nucl 15.5, mito_nucl 12, mito 7.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MFQGINNDRPSTSKLFKVIDFIWNQHELSKLENIRRMLLDCDDSAINNHFVELKAVLMKFTAMTLKSKKRLSQVKKRRSESKNIVDAISEHMKETYHNTIKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.36
4 0.38
5 0.35
6 0.34
7 0.33
8 0.3
9 0.29
10 0.29
11 0.28
12 0.24
13 0.26
14 0.2
15 0.2
16 0.25
17 0.25
18 0.26
19 0.31
20 0.31
21 0.29
22 0.3
23 0.28
24 0.23
25 0.21
26 0.19
27 0.14
28 0.15
29 0.13
30 0.12
31 0.12
32 0.12
33 0.11
34 0.09
35 0.09
36 0.08
37 0.08
38 0.09
39 0.08
40 0.06
41 0.07
42 0.07
43 0.07
44 0.06
45 0.07
46 0.06
47 0.06
48 0.08
49 0.07
50 0.12
51 0.18
52 0.25
53 0.31
54 0.35
55 0.38
56 0.45
57 0.55
58 0.6
59 0.65
60 0.69
61 0.74
62 0.8
63 0.83
64 0.85
65 0.8
66 0.81
67 0.8
68 0.79
69 0.76
70 0.67
71 0.61
72 0.51
73 0.46
74 0.42
75 0.38
76 0.28
77 0.21
78 0.2
79 0.2
80 0.21
81 0.25
82 0.3