Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GY25

Protein Details
Accession L2GY25    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
118-137LHVRSFKKKIRQTQKSIERTHydrophilic
194-213NTNYFDRKSRGKRIGWSNDNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MSAMVDYFYYDYLLYQNIKRFISGERPNFDIIRILSSNLKGLEDQLALKLKLNRIISILQTHECKNMVVCCRFDLLNKLSRCILVQCANSELHNVLLQTYLVIGKKKDAFITDKVYNLHVRSFKKKIRQTQKSIERTYGEKIKTKTLFRIGSEEFEVLFTALMREEVKRVFKTLKVPFLYTISDDKIKEIKTRNTNYFDRKSRGKRIGWSNDNSVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.24
4 0.28
5 0.29
6 0.29
7 0.29
8 0.3
9 0.37
10 0.42
11 0.43
12 0.42
13 0.44
14 0.46
15 0.45
16 0.42
17 0.36
18 0.27
19 0.25
20 0.23
21 0.22
22 0.22
23 0.23
24 0.25
25 0.21
26 0.21
27 0.15
28 0.16
29 0.17
30 0.15
31 0.15
32 0.15
33 0.19
34 0.18
35 0.22
36 0.25
37 0.24
38 0.29
39 0.3
40 0.27
41 0.26
42 0.27
43 0.25
44 0.25
45 0.25
46 0.22
47 0.23
48 0.23
49 0.23
50 0.22
51 0.2
52 0.18
53 0.21
54 0.25
55 0.25
56 0.25
57 0.24
58 0.25
59 0.25
60 0.24
61 0.25
62 0.22
63 0.27
64 0.26
65 0.27
66 0.25
67 0.25
68 0.25
69 0.2
70 0.21
71 0.18
72 0.19
73 0.18
74 0.2
75 0.2
76 0.19
77 0.19
78 0.15
79 0.1
80 0.1
81 0.09
82 0.07
83 0.07
84 0.07
85 0.05
86 0.05
87 0.06
88 0.07
89 0.08
90 0.08
91 0.11
92 0.13
93 0.14
94 0.14
95 0.15
96 0.17
97 0.19
98 0.26
99 0.24
100 0.24
101 0.24
102 0.25
103 0.25
104 0.22
105 0.23
106 0.22
107 0.25
108 0.29
109 0.36
110 0.39
111 0.47
112 0.53
113 0.59
114 0.65
115 0.7
116 0.72
117 0.75
118 0.8
119 0.79
120 0.74
121 0.68
122 0.58
123 0.51
124 0.49
125 0.45
126 0.37
127 0.35
128 0.34
129 0.39
130 0.42
131 0.42
132 0.42
133 0.43
134 0.44
135 0.39
136 0.44
137 0.37
138 0.35
139 0.34
140 0.29
141 0.21
142 0.18
143 0.17
144 0.1
145 0.09
146 0.06
147 0.05
148 0.05
149 0.06
150 0.07
151 0.07
152 0.09
153 0.13
154 0.19
155 0.2
156 0.23
157 0.25
158 0.28
159 0.36
160 0.41
161 0.45
162 0.43
163 0.44
164 0.43
165 0.43
166 0.41
167 0.34
168 0.31
169 0.26
170 0.28
171 0.26
172 0.27
173 0.29
174 0.3
175 0.34
176 0.38
177 0.44
178 0.49
179 0.57
180 0.62
181 0.64
182 0.7
183 0.72
184 0.74
185 0.73
186 0.69
187 0.72
188 0.73
189 0.76
190 0.77
191 0.74
192 0.74
193 0.76
194 0.8
195 0.78
196 0.75