Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GW20

Protein Details
Accession L2GW20    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-41TYAFAGKKRDGKKEQKNEPMNAHydrophilic
NLS Segment(s)
PositionSequence
179-181KKR
Subcellular Location(s) nucl 17.5, mito_nucl 11, cyto 4, mito 3.5
Family & Domain DBs
Amino Acid Sequences MMVLMNILHLISTTALFTFTYAFAGKKRDGKKEQKNEPMNADGVILQPSFGILDKKDDKKNKDDDTRDTFKDSDKIAPIFTKDKRDDKNGNENKKESDDKDEEKAFNNEVMGQSSYKPPMVTMLLNKNKKEEGRKAMLAEYDQLRQRASESLNNIYNIVTTMDKLVDTMKDEDKKGEEKKRKSSAPEERIDYKIIEVTDNDGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.08
4 0.08
5 0.09
6 0.08
7 0.1
8 0.11
9 0.12
10 0.14
11 0.19
12 0.23
13 0.3
14 0.36
15 0.44
16 0.53
17 0.63
18 0.71
19 0.77
20 0.82
21 0.84
22 0.86
23 0.8
24 0.75
25 0.67
26 0.57
27 0.46
28 0.37
29 0.27
30 0.2
31 0.17
32 0.12
33 0.09
34 0.08
35 0.07
36 0.07
37 0.08
38 0.09
39 0.07
40 0.15
41 0.22
42 0.28
43 0.37
44 0.44
45 0.47
46 0.53
47 0.62
48 0.63
49 0.65
50 0.64
51 0.63
52 0.64
53 0.65
54 0.58
55 0.53
56 0.45
57 0.38
58 0.37
59 0.31
60 0.27
61 0.24
62 0.23
63 0.21
64 0.22
65 0.22
66 0.25
67 0.26
68 0.3
69 0.31
70 0.38
71 0.4
72 0.46
73 0.5
74 0.5
75 0.58
76 0.58
77 0.62
78 0.58
79 0.56
80 0.51
81 0.49
82 0.46
83 0.36
84 0.35
85 0.32
86 0.3
87 0.33
88 0.33
89 0.29
90 0.29
91 0.29
92 0.22
93 0.18
94 0.16
95 0.13
96 0.11
97 0.12
98 0.1
99 0.09
100 0.1
101 0.11
102 0.12
103 0.12
104 0.11
105 0.1
106 0.11
107 0.12
108 0.13
109 0.15
110 0.24
111 0.32
112 0.37
113 0.37
114 0.38
115 0.39
116 0.42
117 0.45
118 0.43
119 0.42
120 0.44
121 0.46
122 0.45
123 0.43
124 0.4
125 0.33
126 0.29
127 0.23
128 0.21
129 0.22
130 0.21
131 0.19
132 0.18
133 0.19
134 0.2
135 0.21
136 0.22
137 0.23
138 0.28
139 0.31
140 0.31
141 0.3
142 0.26
143 0.23
144 0.18
145 0.16
146 0.11
147 0.08
148 0.09
149 0.09
150 0.09
151 0.09
152 0.1
153 0.1
154 0.13
155 0.16
156 0.22
157 0.25
158 0.27
159 0.29
160 0.32
161 0.38
162 0.43
163 0.5
164 0.53
165 0.58
166 0.67
167 0.74
168 0.76
169 0.76
170 0.78
171 0.78
172 0.77
173 0.76
174 0.72
175 0.68
176 0.64
177 0.59
178 0.49
179 0.39
180 0.34
181 0.27
182 0.22
183 0.18