Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GV60

Protein Details
Accession L2GV60    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
93-114LSKEQLRKCRNGKSRAYKGGLRHydrophilic
NLS Segment(s)
PositionSequence
87-108KKKRMALSKEQLRKCRNGKSRA
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
Amino Acid Sequences MKVNAKDLRCLTLSEVEERYKQVKTDLLHMRQREQTQTVKPHEIYQAHRNVAVVMTILTDKKKEEAVAAAFAANGKVPKQFLTRLTKKKRMALSKEQLRKCRNGKSRAYKGGLRRVLFAYAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.3
4 0.31
5 0.33
6 0.32
7 0.26
8 0.25
9 0.23
10 0.25
11 0.23
12 0.31
13 0.37
14 0.42
15 0.47
16 0.48
17 0.5
18 0.51
19 0.52
20 0.47
21 0.42
22 0.4
23 0.41
24 0.47
25 0.47
26 0.46
27 0.44
28 0.43
29 0.45
30 0.42
31 0.4
32 0.4
33 0.41
34 0.36
35 0.36
36 0.33
37 0.28
38 0.24
39 0.19
40 0.11
41 0.05
42 0.05
43 0.05
44 0.06
45 0.06
46 0.07
47 0.07
48 0.08
49 0.08
50 0.08
51 0.08
52 0.1
53 0.11
54 0.11
55 0.11
56 0.1
57 0.09
58 0.09
59 0.08
60 0.06
61 0.06
62 0.05
63 0.07
64 0.07
65 0.1
66 0.13
67 0.16
68 0.22
69 0.32
70 0.41
71 0.5
72 0.59
73 0.66
74 0.68
75 0.72
76 0.74
77 0.74
78 0.72
79 0.73
80 0.74
81 0.75
82 0.8
83 0.8
84 0.8
85 0.75
86 0.76
87 0.72
88 0.72
89 0.71
90 0.71
91 0.74
92 0.76
93 0.81
94 0.82
95 0.81
96 0.77
97 0.76
98 0.77
99 0.74
100 0.64
101 0.58
102 0.51