Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GTP9

Protein Details
Accession L2GTP9   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPRPKKSTPPPRSPKKKLLDDKTCYSCHydrophilic
NLS Segment(s)
PositionSequence
4-17PKKSTPPPRSPKKK
Subcellular Location(s) mito_nucl 12.999, mito 12.5, nucl 12, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS00344  GATA_ZN_FINGER_1  
PS50114  GATA_ZN_FINGER_2  
Amino Acid Sequences MPRPKKSTPPPRSPKKKLLDDKTCYSCKRKDTPYWREGWRPSVILCNACGLRYSKYRRVCTLCNKVGVKANFEKVSCPKCKSTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.87
3 0.88
4 0.87
5 0.87
6 0.86
7 0.82
8 0.81
9 0.77
10 0.74
11 0.67
12 0.62
13 0.57
14 0.54
15 0.55
16 0.54
17 0.58
18 0.62
19 0.68
20 0.68
21 0.68
22 0.64
23 0.63
24 0.58
25 0.52
26 0.43
27 0.35
28 0.3
29 0.29
30 0.27
31 0.21
32 0.19
33 0.18
34 0.16
35 0.15
36 0.16
37 0.13
38 0.15
39 0.22
40 0.29
41 0.34
42 0.43
43 0.47
44 0.52
45 0.56
46 0.6
47 0.63
48 0.66
49 0.62
50 0.62
51 0.59
52 0.55
53 0.58
54 0.52
55 0.48
56 0.43
57 0.46
58 0.42
59 0.41
60 0.43
61 0.43
62 0.5
63 0.5
64 0.5