Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GQT8

Protein Details
Accession L2GQT8   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-53VNVPKTRRTYCKKCGCYQEKKQSLAKKSKENPRRQGARRYKRKQKGCHGQTKPHydrophilic
NLS Segment(s)
PositionSequence
23-64SLAKKSKENPRRQGARRYKRKQKGCHGQTKPILRRKAKVTKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences VNVPKTRRTYCKKCGCYQEKKQSLAKKSKENPRRQGARRYKRKQKGCHGQTKPILRRKAKVTKKLVLKLECTKCKQIELKVCRRAKHVEFGGEKKVKGEALVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.83
4 0.84
5 0.85
6 0.82
7 0.79
8 0.79
9 0.76
10 0.75
11 0.75
12 0.7
13 0.69
14 0.7
15 0.76
16 0.79
17 0.8
18 0.8
19 0.8
20 0.84
21 0.79
22 0.81
23 0.82
24 0.83
25 0.84
26 0.85
27 0.86
28 0.85
29 0.89
30 0.87
31 0.87
32 0.87
33 0.85
34 0.85
35 0.78
36 0.77
37 0.73
38 0.73
39 0.7
40 0.67
41 0.66
42 0.58
43 0.58
44 0.59
45 0.63
46 0.63
47 0.65
48 0.64
49 0.63
50 0.69
51 0.71
52 0.7
53 0.62
54 0.59
55 0.59
56 0.61
57 0.61
58 0.57
59 0.57
60 0.51
61 0.53
62 0.53
63 0.51
64 0.52
65 0.55
66 0.61
67 0.64
68 0.68
69 0.65
70 0.64
71 0.65
72 0.58
73 0.59
74 0.53
75 0.52
76 0.54
77 0.56
78 0.61
79 0.57
80 0.53
81 0.44
82 0.42
83 0.34