Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GTL1

Protein Details
Accession L2GTL1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
79-100VCTIRDRVKKRKARMWSRRGLEHydrophilic
NLS Segment(s)
PositionSequence
86-93VKKRKARM
Subcellular Location(s) plas 10, E.R. 5, mito 4, extr 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045103  RNF5/RNF185-like  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0046872  F:metal ion binding  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0016567  P:protein ubiquitination  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF15227  zf-C3HC4_4  
PROSITE View protein in PROSITE  
PS00518  ZF_RING_1  
PS50089  ZF_RING_2  
Amino Acid Sequences MAGNRYLECRVCLNVLYEPVSLTCGHVFCWPCIYQWSSTSSCCPVCMQRMTEYIPLYVDLPLDLDREVDGRVPARPDAVCTIRDRVKKRKARMWSRRGLEIFLILLFLYIGFQLAFRREKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.2
5 0.19
6 0.17
7 0.18
8 0.15
9 0.14
10 0.13
11 0.11
12 0.12
13 0.17
14 0.18
15 0.17
16 0.22
17 0.2
18 0.19
19 0.22
20 0.23
21 0.2
22 0.2
23 0.25
24 0.22
25 0.23
26 0.24
27 0.25
28 0.22
29 0.21
30 0.21
31 0.19
32 0.22
33 0.24
34 0.23
35 0.23
36 0.25
37 0.27
38 0.29
39 0.26
40 0.21
41 0.19
42 0.17
43 0.14
44 0.12
45 0.09
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.08
59 0.1
60 0.1
61 0.11
62 0.11
63 0.12
64 0.16
65 0.17
66 0.18
67 0.19
68 0.24
69 0.28
70 0.35
71 0.4
72 0.46
73 0.54
74 0.61
75 0.67
76 0.7
77 0.74
78 0.79
79 0.84
80 0.83
81 0.83
82 0.78
83 0.78
84 0.71
85 0.62
86 0.52
87 0.42
88 0.33
89 0.23
90 0.19
91 0.11
92 0.09
93 0.07
94 0.06
95 0.05
96 0.04
97 0.04
98 0.04
99 0.05
100 0.08
101 0.13