Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GYC6

Protein Details
Accession L2GYC6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
22-46EYIKKILAMKQKRARKARKDLEPGMHydrophilic
NLS Segment(s)
PositionSequence
31-40KQKRARKARK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000915  60S_ribosomal_L6E  
IPR014722  Rib_L2_dom2  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Amino Acid Sequences MERKLQIMPPKAGYYPMDDMPEYIKKILAMKQKRARKARKDLEPGMIVVVLEGQYSGSRVVFLKQTEDNRAVCIGPSSVNNIPLFSIDERFLLSTSTILKVNDYDLKDVKECSMDVNYENNESETSELERRIEGDVLKEIAKMKFMKTYLKSPFKVTDNEHPLAFNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.31
4 0.29
5 0.26
6 0.26
7 0.27
8 0.3
9 0.26
10 0.23
11 0.21
12 0.19
13 0.23
14 0.28
15 0.34
16 0.37
17 0.46
18 0.54
19 0.62
20 0.7
21 0.77
22 0.81
23 0.81
24 0.85
25 0.84
26 0.85
27 0.85
28 0.8
29 0.75
30 0.66
31 0.56
32 0.46
33 0.36
34 0.26
35 0.16
36 0.13
37 0.07
38 0.05
39 0.05
40 0.04
41 0.04
42 0.05
43 0.05
44 0.05
45 0.06
46 0.06
47 0.08
48 0.11
49 0.11
50 0.14
51 0.17
52 0.2
53 0.23
54 0.26
55 0.25
56 0.23
57 0.23
58 0.2
59 0.16
60 0.14
61 0.1
62 0.08
63 0.08
64 0.12
65 0.12
66 0.14
67 0.14
68 0.13
69 0.13
70 0.13
71 0.14
72 0.1
73 0.1
74 0.08
75 0.08
76 0.09
77 0.09
78 0.09
79 0.07
80 0.07
81 0.06
82 0.07
83 0.08
84 0.09
85 0.09
86 0.09
87 0.09
88 0.12
89 0.16
90 0.16
91 0.17
92 0.18
93 0.19
94 0.2
95 0.2
96 0.18
97 0.15
98 0.14
99 0.13
100 0.13
101 0.12
102 0.13
103 0.17
104 0.17
105 0.17
106 0.18
107 0.16
108 0.15
109 0.14
110 0.13
111 0.11
112 0.13
113 0.14
114 0.15
115 0.15
116 0.15
117 0.15
118 0.16
119 0.17
120 0.14
121 0.14
122 0.16
123 0.17
124 0.17
125 0.17
126 0.19
127 0.17
128 0.22
129 0.21
130 0.2
131 0.24
132 0.26
133 0.34
134 0.35
135 0.43
136 0.49
137 0.56
138 0.56
139 0.55
140 0.6
141 0.55
142 0.58
143 0.54
144 0.55
145 0.54
146 0.54
147 0.49