Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GTF5

Protein Details
Accession L2GTF5    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-28KLNTSISSSRRKQRKKHFNAKSTDLTKHydrophilic
NLS Segment(s)
PositionSequence
12-17RKQRKK
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF16906  Ribosomal_L26  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MKLNTSISSSRRKQRKKHFNAKSTDLTKQMTAPLSKALKEEIGIKRIPVRPNDIVLVRVGKYKKTEGKVVKVNRIARKICVEGVSITKKDGAVRYLGVHPSNLSIVRLSMEYDRNKVIEKIKGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.86
3 0.87
4 0.9
5 0.91
6 0.89
7 0.88
8 0.84
9 0.82
10 0.75
11 0.68
12 0.61
13 0.52
14 0.44
15 0.38
16 0.34
17 0.29
18 0.25
19 0.22
20 0.25
21 0.24
22 0.24
23 0.24
24 0.21
25 0.18
26 0.18
27 0.25
28 0.22
29 0.23
30 0.23
31 0.22
32 0.28
33 0.33
34 0.35
35 0.3
36 0.33
37 0.31
38 0.33
39 0.34
40 0.28
41 0.24
42 0.21
43 0.2
44 0.14
45 0.17
46 0.15
47 0.15
48 0.17
49 0.21
50 0.26
51 0.27
52 0.35
53 0.34
54 0.4
55 0.47
56 0.49
57 0.51
58 0.51
59 0.56
60 0.53
61 0.56
62 0.51
63 0.45
64 0.45
65 0.4
66 0.35
67 0.3
68 0.25
69 0.2
70 0.24
71 0.26
72 0.22
73 0.21
74 0.2
75 0.2
76 0.21
77 0.22
78 0.18
79 0.15
80 0.16
81 0.18
82 0.21
83 0.24
84 0.22
85 0.2
86 0.19
87 0.19
88 0.2
89 0.18
90 0.15
91 0.12
92 0.12
93 0.12
94 0.12
95 0.13
96 0.15
97 0.21
98 0.24
99 0.27
100 0.29
101 0.29
102 0.31
103 0.34
104 0.35