Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GX95

Protein Details
Accession L2GX95   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
371-396IKIFEKLKTMRKNFNKRKEYNSKFTYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043154  Sec-1-like_dom1  
IPR043127  Sec-1-like_dom3a  
IPR001619  Sec1-like  
IPR027482  Sec1-like_dom2  
IPR036045  Sec1-like_sf  
Gene Ontology GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF00995  Sec1  
Amino Acid Sequences MNLKEMMRDKIVKDVLRPSSEDEWHVFVYNASTARILTYIFTKTQILSNEILSMQRLELKRDPIPYPAIYFVTHCKETYKAIKKDVKNKIYTKYYVVHTNRINENDKIIGENIFYKYVDINFVVINERIFTGLNGVGDAIRSFSSILKLRFNVINLRADTDLYEQLKTCSSTSESRNEYYNSDLIVLDRSFDMIVPLIHFFNFESLIHDLNLCENNTDESPLYREIRYMHIADTNSVLNSKAQKLVEGMKKIDKKTDINEIHKLVLEAPENIKLKESVNRYINLAEDTLNLFEKEQLNYIATFEQNISTGYDNKGNRYHGGLKDVFGILNQKIRRENKFRLVLLLLSTHYDFQTNEVTKLKEKLMLTDQEIKIFEKLKTMRKNFNKRKEYNSKFTYEISRYDPLLHDLLRAFVQNKNNRFSNLVKRETTEKKESLRKSSFVFMKHEAKKKTLVLYIDVVTYPEMMLINQMSEKSSYEIFVCTNQVVTPKEYLKWLGEIKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.48
4 0.49
5 0.46
6 0.46
7 0.47
8 0.45
9 0.39
10 0.36
11 0.34
12 0.33
13 0.27
14 0.21
15 0.2
16 0.21
17 0.19
18 0.16
19 0.15
20 0.14
21 0.15
22 0.15
23 0.13
24 0.1
25 0.13
26 0.16
27 0.16
28 0.18
29 0.19
30 0.19
31 0.23
32 0.25
33 0.25
34 0.23
35 0.23
36 0.23
37 0.22
38 0.22
39 0.18
40 0.17
41 0.14
42 0.19
43 0.19
44 0.23
45 0.28
46 0.33
47 0.36
48 0.4
49 0.41
50 0.39
51 0.43
52 0.38
53 0.36
54 0.33
55 0.31
56 0.26
57 0.27
58 0.28
59 0.3
60 0.3
61 0.27
62 0.26
63 0.26
64 0.32
65 0.41
66 0.45
67 0.44
68 0.52
69 0.6
70 0.66
71 0.74
72 0.78
73 0.76
74 0.75
75 0.75
76 0.74
77 0.72
78 0.67
79 0.61
80 0.56
81 0.51
82 0.52
83 0.5
84 0.49
85 0.46
86 0.5
87 0.51
88 0.51
89 0.52
90 0.43
91 0.42
92 0.37
93 0.33
94 0.28
95 0.24
96 0.19
97 0.15
98 0.18
99 0.17
100 0.16
101 0.16
102 0.14
103 0.15
104 0.15
105 0.16
106 0.13
107 0.12
108 0.11
109 0.12
110 0.14
111 0.13
112 0.12
113 0.1
114 0.1
115 0.1
116 0.1
117 0.09
118 0.09
119 0.1
120 0.09
121 0.09
122 0.09
123 0.08
124 0.08
125 0.08
126 0.07
127 0.06
128 0.06
129 0.07
130 0.07
131 0.12
132 0.17
133 0.19
134 0.22
135 0.23
136 0.26
137 0.27
138 0.28
139 0.29
140 0.28
141 0.31
142 0.28
143 0.29
144 0.26
145 0.25
146 0.24
147 0.21
148 0.22
149 0.17
150 0.18
151 0.16
152 0.16
153 0.18
154 0.18
155 0.16
156 0.13
157 0.15
158 0.2
159 0.23
160 0.29
161 0.31
162 0.31
163 0.33
164 0.33
165 0.31
166 0.28
167 0.25
168 0.18
169 0.16
170 0.15
171 0.12
172 0.14
173 0.12
174 0.1
175 0.09
176 0.09
177 0.08
178 0.08
179 0.08
180 0.06
181 0.06
182 0.06
183 0.07
184 0.07
185 0.07
186 0.08
187 0.07
188 0.07
189 0.08
190 0.07
191 0.09
192 0.1
193 0.11
194 0.11
195 0.11
196 0.1
197 0.11
198 0.13
199 0.1
200 0.09
201 0.09
202 0.1
203 0.1
204 0.12
205 0.1
206 0.08
207 0.1
208 0.13
209 0.15
210 0.13
211 0.14
212 0.14
213 0.18
214 0.2
215 0.18
216 0.16
217 0.18
218 0.18
219 0.17
220 0.17
221 0.14
222 0.12
223 0.11
224 0.11
225 0.09
226 0.11
227 0.11
228 0.14
229 0.13
230 0.14
231 0.15
232 0.22
233 0.25
234 0.25
235 0.26
236 0.28
237 0.33
238 0.33
239 0.35
240 0.31
241 0.29
242 0.29
243 0.38
244 0.37
245 0.36
246 0.4
247 0.38
248 0.35
249 0.33
250 0.31
251 0.21
252 0.18
253 0.15
254 0.12
255 0.12
256 0.17
257 0.17
258 0.17
259 0.17
260 0.15
261 0.16
262 0.2
263 0.23
264 0.24
265 0.26
266 0.26
267 0.27
268 0.27
269 0.26
270 0.21
271 0.18
272 0.12
273 0.1
274 0.1
275 0.09
276 0.09
277 0.09
278 0.08
279 0.1
280 0.12
281 0.11
282 0.12
283 0.12
284 0.12
285 0.12
286 0.13
287 0.11
288 0.1
289 0.1
290 0.09
291 0.08
292 0.08
293 0.08
294 0.09
295 0.09
296 0.11
297 0.12
298 0.18
299 0.18
300 0.21
301 0.24
302 0.24
303 0.24
304 0.27
305 0.32
306 0.27
307 0.33
308 0.3
309 0.27
310 0.28
311 0.27
312 0.22
313 0.16
314 0.18
315 0.12
316 0.18
317 0.18
318 0.19
319 0.27
320 0.32
321 0.4
322 0.45
323 0.51
324 0.54
325 0.6
326 0.57
327 0.53
328 0.49
329 0.42
330 0.35
331 0.29
332 0.2
333 0.15
334 0.15
335 0.12
336 0.11
337 0.12
338 0.1
339 0.11
340 0.19
341 0.19
342 0.21
343 0.23
344 0.25
345 0.26
346 0.3
347 0.28
348 0.26
349 0.24
350 0.26
351 0.29
352 0.31
353 0.32
354 0.39
355 0.38
356 0.36
357 0.37
358 0.34
359 0.31
360 0.3
361 0.26
362 0.25
363 0.3
364 0.36
365 0.45
366 0.5
367 0.57
368 0.65
369 0.76
370 0.79
371 0.84
372 0.85
373 0.8
374 0.85
375 0.86
376 0.83
377 0.82
378 0.76
379 0.69
380 0.61
381 0.59
382 0.56
383 0.48
384 0.43
385 0.38
386 0.36
387 0.33
388 0.33
389 0.31
390 0.27
391 0.27
392 0.24
393 0.21
394 0.18
395 0.19
396 0.17
397 0.18
398 0.17
399 0.19
400 0.28
401 0.34
402 0.39
403 0.43
404 0.45
405 0.45
406 0.47
407 0.49
408 0.51
409 0.52
410 0.53
411 0.49
412 0.49
413 0.55
414 0.6
415 0.61
416 0.58
417 0.54
418 0.56
419 0.63
420 0.67
421 0.68
422 0.65
423 0.61
424 0.56
425 0.6
426 0.56
427 0.51
428 0.51
429 0.48
430 0.53
431 0.58
432 0.63
433 0.58
434 0.57
435 0.59
436 0.58
437 0.57
438 0.52
439 0.46
440 0.41
441 0.41
442 0.38
443 0.33
444 0.29
445 0.24
446 0.19
447 0.17
448 0.13
449 0.1
450 0.09
451 0.07
452 0.1
453 0.09
454 0.11
455 0.12
456 0.12
457 0.12
458 0.14
459 0.15
460 0.15
461 0.16
462 0.16
463 0.15
464 0.17
465 0.17
466 0.18
467 0.2
468 0.17
469 0.17
470 0.17
471 0.22
472 0.23
473 0.24
474 0.28
475 0.28
476 0.3
477 0.32
478 0.35
479 0.32
480 0.35