Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GVL0

Protein Details
Accession L2GVL0   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
196-216GQTVCLPKKPKCKECVVNYCCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 10.333, mito_nucl 10.166, mito 8.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR004035  Endouclease-III_FeS-bd_BS  
IPR003265  HhH-GPD_domain  
IPR023170  HhH_base_excis_C  
Gene Ontology GO:0000702  F:oxidized base lesion DNA N-glycosylase activity  
GO:0006285  P:base-excision repair, AP site formation  
Pfam View protein in Pfam  
PF00730  HhH-GPD  
PROSITE View protein in PROSITE  
PS00764  ENDONUCLEASE_III_1  
CDD cd00056  ENDO3c  
Amino Acid Sequences MKEVLQVIKEQRKSLIAPVDTMGCSCIPFTKDEEHKKFRTLVMLMLSQQTRDQTTYTTVHNLNESLVKKYNEGISPRTVSLLSLDELSSSIKAVNYYIKKAKNIKIIAEYFLDKKMATEYDALIKLPGVGNKIAFLYLQIACNKTVGIGVDTHVHRIFNRLGIVTTRTPEETRIKLEQIYDRREWKEINKVMVGFGQTVCLPKKPKCKECVVNYCCKYGRKFSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.34
4 0.33
5 0.32
6 0.33
7 0.29
8 0.27
9 0.22
10 0.14
11 0.13
12 0.12
13 0.14
14 0.12
15 0.14
16 0.18
17 0.25
18 0.34
19 0.44
20 0.53
21 0.57
22 0.58
23 0.6
24 0.6
25 0.53
26 0.5
27 0.41
28 0.35
29 0.31
30 0.3
31 0.27
32 0.29
33 0.27
34 0.21
35 0.22
36 0.2
37 0.18
38 0.17
39 0.17
40 0.14
41 0.18
42 0.19
43 0.2
44 0.23
45 0.23
46 0.22
47 0.23
48 0.22
49 0.18
50 0.22
51 0.21
52 0.2
53 0.24
54 0.24
55 0.23
56 0.25
57 0.28
58 0.27
59 0.28
60 0.28
61 0.27
62 0.28
63 0.28
64 0.27
65 0.22
66 0.18
67 0.16
68 0.15
69 0.11
70 0.09
71 0.09
72 0.08
73 0.08
74 0.09
75 0.07
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07
81 0.13
82 0.14
83 0.19
84 0.24
85 0.26
86 0.31
87 0.37
88 0.42
89 0.43
90 0.43
91 0.41
92 0.41
93 0.39
94 0.36
95 0.31
96 0.27
97 0.2
98 0.19
99 0.17
100 0.11
101 0.1
102 0.1
103 0.09
104 0.09
105 0.09
106 0.09
107 0.12
108 0.13
109 0.12
110 0.11
111 0.1
112 0.1
113 0.1
114 0.11
115 0.08
116 0.09
117 0.09
118 0.09
119 0.09
120 0.09
121 0.08
122 0.07
123 0.08
124 0.09
125 0.12
126 0.13
127 0.14
128 0.14
129 0.14
130 0.13
131 0.1
132 0.1
133 0.08
134 0.08
135 0.07
136 0.08
137 0.13
138 0.13
139 0.16
140 0.16
141 0.16
142 0.15
143 0.19
144 0.19
145 0.16
146 0.17
147 0.15
148 0.15
149 0.17
150 0.21
151 0.18
152 0.19
153 0.18
154 0.18
155 0.19
156 0.23
157 0.27
158 0.26
159 0.3
160 0.32
161 0.32
162 0.31
163 0.34
164 0.37
165 0.39
166 0.42
167 0.42
168 0.45
169 0.45
170 0.47
171 0.46
172 0.44
173 0.47
174 0.45
175 0.45
176 0.42
177 0.4
178 0.38
179 0.37
180 0.33
181 0.24
182 0.19
183 0.17
184 0.14
185 0.18
186 0.18
187 0.22
188 0.26
189 0.32
190 0.43
191 0.52
192 0.6
193 0.62
194 0.71
195 0.75
196 0.8
197 0.84
198 0.8
199 0.8
200 0.74
201 0.74
202 0.69
203 0.65
204 0.59