Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GRW1

Protein Details
Accession L2GRW1   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-28LFDIVQKIHRKSKKRKLTDYLHLCDHydrophilic
NLS Segment(s)
PositionSequence
13-19RKSKKRK
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences VDSLFDIVQKIHRKSKKRKLTDYLHLCDVLYLFNERLDQILKNIRQNKQEYFDMTDDDFNAFRSQEFYSIIVEQLKTAYLKHLKCVKKYLYALSYGACWLINFTQAKNNGNSAKQAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.76
3 0.8
4 0.82
5 0.86
6 0.86
7 0.87
8 0.87
9 0.85
10 0.79
11 0.71
12 0.61
13 0.51
14 0.42
15 0.33
16 0.23
17 0.14
18 0.12
19 0.09
20 0.09
21 0.1
22 0.1
23 0.1
24 0.11
25 0.1
26 0.12
27 0.19
28 0.21
29 0.28
30 0.35
31 0.39
32 0.44
33 0.47
34 0.47
35 0.44
36 0.43
37 0.38
38 0.36
39 0.32
40 0.27
41 0.24
42 0.21
43 0.17
44 0.15
45 0.13
46 0.09
47 0.09
48 0.08
49 0.07
50 0.09
51 0.09
52 0.09
53 0.1
54 0.1
55 0.11
56 0.11
57 0.12
58 0.11
59 0.11
60 0.1
61 0.09
62 0.09
63 0.08
64 0.08
65 0.14
66 0.19
67 0.2
68 0.27
69 0.36
70 0.4
71 0.43
72 0.51
73 0.48
74 0.49
75 0.52
76 0.51
77 0.45
78 0.43
79 0.4
80 0.32
81 0.29
82 0.21
83 0.19
84 0.13
85 0.1
86 0.1
87 0.1
88 0.15
89 0.16
90 0.17
91 0.23
92 0.28
93 0.31
94 0.31
95 0.38
96 0.36
97 0.37