Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GRM7

Protein Details
Accession L2GRM7    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
133-160TAMTLKSKKRLNQVKKRKSESKNIVDAIHydrophilic
NLS Segment(s)
PositionSequence
140-150KKRLNQVKKRK
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 3, cyto 2
Family & Domain DBs
Amino Acid Sequences TFSCVIKMMQCSDSDGTLQNCARNMDDLINPVDVDNPDDSEATSTCLRRNESQNTYHRSISYLQHYKQTHGYMFQGINNDRPSTKKLFKVIDFIWNQHELSKLENIRIMLLHCDDSAINNHFVELKAVLMKFTAMTLKSKKRLNQVKKRKSESKNIVDAISEYMKETYHNTIKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.21
4 0.25
5 0.26
6 0.24
7 0.25
8 0.25
9 0.25
10 0.23
11 0.23
12 0.2
13 0.2
14 0.2
15 0.2
16 0.19
17 0.18
18 0.16
19 0.17
20 0.14
21 0.15
22 0.13
23 0.12
24 0.12
25 0.13
26 0.13
27 0.12
28 0.12
29 0.13
30 0.15
31 0.15
32 0.17
33 0.21
34 0.24
35 0.28
36 0.34
37 0.4
38 0.42
39 0.49
40 0.54
41 0.57
42 0.57
43 0.53
44 0.46
45 0.4
46 0.37
47 0.33
48 0.35
49 0.35
50 0.32
51 0.39
52 0.39
53 0.39
54 0.41
55 0.39
56 0.3
57 0.25
58 0.25
59 0.21
60 0.21
61 0.2
62 0.2
63 0.18
64 0.21
65 0.21
66 0.2
67 0.18
68 0.19
69 0.21
70 0.23
71 0.26
72 0.26
73 0.3
74 0.33
75 0.34
76 0.37
77 0.34
78 0.36
79 0.33
80 0.3
81 0.28
82 0.25
83 0.24
84 0.2
85 0.22
86 0.14
87 0.15
88 0.19
89 0.17
90 0.16
91 0.18
92 0.17
93 0.15
94 0.16
95 0.14
96 0.11
97 0.11
98 0.11
99 0.09
100 0.1
101 0.09
102 0.1
103 0.13
104 0.14
105 0.14
106 0.13
107 0.13
108 0.14
109 0.14
110 0.14
111 0.1
112 0.09
113 0.1
114 0.1
115 0.1
116 0.09
117 0.1
118 0.08
119 0.09
120 0.11
121 0.09
122 0.15
123 0.23
124 0.31
125 0.37
126 0.43
127 0.48
128 0.55
129 0.65
130 0.71
131 0.74
132 0.78
133 0.82
134 0.87
135 0.9
136 0.9
137 0.86
138 0.86
139 0.85
140 0.83
141 0.81
142 0.72
143 0.64
144 0.54
145 0.49
146 0.42
147 0.34
148 0.25
149 0.18
150 0.17
151 0.16
152 0.17
153 0.19
154 0.23