Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GVR0

Protein Details
Accession L2GVR0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
28-47RKVVRGRKACQKAIKNRKKGBasic
NLS Segment(s)
PositionSequence
28-46RKVVRGRKACQKAIKNRKK
Subcellular Location(s) cyto 15, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
Amino Acid Sequences MIKFAAPVLPHEATAHIVRIIDHLKASRKVVRGRKACQKAIKNRKKGILILPFNISPSDLITHLPMLCENNGVKYCYVDGEVLKKASNVNTPSCCVFVKKSAAYLEDYNVVKSAITSGCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.14
4 0.14
5 0.13
6 0.16
7 0.17
8 0.15
9 0.15
10 0.18
11 0.23
12 0.26
13 0.3
14 0.32
15 0.37
16 0.45
17 0.52
18 0.58
19 0.59
20 0.63
21 0.69
22 0.71
23 0.72
24 0.72
25 0.72
26 0.74
27 0.78
28 0.81
29 0.79
30 0.76
31 0.75
32 0.7
33 0.63
34 0.6
35 0.59
36 0.51
37 0.44
38 0.41
39 0.35
40 0.33
41 0.29
42 0.21
43 0.12
44 0.1
45 0.09
46 0.07
47 0.07
48 0.07
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.09
56 0.09
57 0.11
58 0.12
59 0.14
60 0.13
61 0.12
62 0.13
63 0.11
64 0.12
65 0.1
66 0.1
67 0.13
68 0.15
69 0.15
70 0.15
71 0.15
72 0.15
73 0.17
74 0.22
75 0.22
76 0.25
77 0.27
78 0.29
79 0.3
80 0.3
81 0.28
82 0.25
83 0.24
84 0.25
85 0.29
86 0.28
87 0.31
88 0.31
89 0.32
90 0.33
91 0.32
92 0.29
93 0.28
94 0.28
95 0.24
96 0.22
97 0.21
98 0.16
99 0.15
100 0.17