Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GX47

Protein Details
Accession L2GX47   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
67-86IYRKVKIVSKKKLKGKHVEYBasic
NLS Segment(s)
PositionSequence
75-81SKKKLKG
Subcellular Location(s) nucl 15, cyto 8, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR031515  DUF5095  
Pfam View protein in Pfam  
PF17016  DUF5095  
Amino Acid Sequences MNDYQSNITNCPSDNPFGGTNVVRKQRINLNEKVRTNKFNDDIFIKQLIKRDVGMKNTPTRCNTMNIYRKVKIVSKKKLKGKHVEYFKFPFNTNIKNDSSDLYSLIYMEWLIAITSAFKNYRNRNEEFYIKFLDKLLIFSTDLYCSSACKEILDQLEIQYVDENSLLKVTGVGISLMYDYVINYELKPKDRMPFILSRHKFTNAISYESRFTESLMVRDRGVLKCYYVIEGYLYGCDFAEYFKEDVAVEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.25
4 0.25
5 0.28
6 0.25
7 0.28
8 0.33
9 0.39
10 0.38
11 0.38
12 0.41
13 0.46
14 0.53
15 0.54
16 0.55
17 0.57
18 0.63
19 0.67
20 0.71
21 0.68
22 0.65
23 0.63
24 0.63
25 0.57
26 0.5
27 0.48
28 0.43
29 0.4
30 0.38
31 0.37
32 0.31
33 0.29
34 0.33
35 0.32
36 0.29
37 0.28
38 0.32
39 0.32
40 0.37
41 0.4
42 0.4
43 0.46
44 0.51
45 0.54
46 0.5
47 0.49
48 0.45
49 0.43
50 0.43
51 0.44
52 0.47
53 0.5
54 0.54
55 0.52
56 0.52
57 0.51
58 0.52
59 0.52
60 0.53
61 0.56
62 0.6
63 0.67
64 0.73
65 0.78
66 0.8
67 0.8
68 0.78
69 0.76
70 0.76
71 0.71
72 0.68
73 0.63
74 0.6
75 0.52
76 0.44
77 0.42
78 0.36
79 0.38
80 0.36
81 0.37
82 0.33
83 0.33
84 0.33
85 0.27
86 0.25
87 0.19
88 0.17
89 0.13
90 0.11
91 0.09
92 0.08
93 0.07
94 0.05
95 0.04
96 0.04
97 0.03
98 0.03
99 0.03
100 0.03
101 0.04
102 0.04
103 0.07
104 0.07
105 0.11
106 0.18
107 0.24
108 0.33
109 0.36
110 0.38
111 0.41
112 0.43
113 0.45
114 0.41
115 0.37
116 0.31
117 0.27
118 0.25
119 0.21
120 0.19
121 0.14
122 0.13
123 0.12
124 0.1
125 0.1
126 0.1
127 0.11
128 0.1
129 0.1
130 0.1
131 0.09
132 0.08
133 0.09
134 0.11
135 0.11
136 0.1
137 0.1
138 0.14
139 0.15
140 0.16
141 0.15
142 0.13
143 0.16
144 0.15
145 0.15
146 0.11
147 0.1
148 0.09
149 0.09
150 0.09
151 0.06
152 0.06
153 0.06
154 0.05
155 0.05
156 0.05
157 0.06
158 0.06
159 0.06
160 0.05
161 0.06
162 0.06
163 0.06
164 0.05
165 0.04
166 0.04
167 0.05
168 0.06
169 0.07
170 0.07
171 0.14
172 0.17
173 0.2
174 0.24
175 0.26
176 0.3
177 0.32
178 0.35
179 0.34
180 0.38
181 0.41
182 0.49
183 0.49
184 0.48
185 0.48
186 0.49
187 0.44
188 0.38
189 0.41
190 0.32
191 0.35
192 0.33
193 0.32
194 0.32
195 0.32
196 0.34
197 0.24
198 0.23
199 0.24
200 0.23
201 0.26
202 0.3
203 0.3
204 0.27
205 0.31
206 0.35
207 0.31
208 0.32
209 0.28
210 0.23
211 0.25
212 0.26
213 0.24
214 0.2
215 0.18
216 0.17
217 0.17
218 0.16
219 0.14
220 0.13
221 0.11
222 0.11
223 0.11
224 0.09
225 0.09
226 0.11
227 0.13
228 0.13
229 0.13
230 0.14