Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3S5K7

Protein Details
Accession E3S5K7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-31GAEYRNYRSKRRKASKTFGAYYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 11, cyto 2.5, golg 2, plas 1, pero 1, E.R. 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pte:PTT_17924  -  
Amino Acid Sequences MALHKITTFGAEYRNYRSKRRKASKTFGAYYSISGILRQIIWALVLILVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.45
4 0.54
5 0.59
6 0.66
7 0.74
8 0.77
9 0.78
10 0.84
11 0.84
12 0.81
13 0.74
14 0.64
15 0.58
16 0.48
17 0.39
18 0.32
19 0.24
20 0.17
21 0.14
22 0.13
23 0.1
24 0.1
25 0.09
26 0.08
27 0.06
28 0.07
29 0.07
30 0.07