Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GXI1

Protein Details
Accession L2GXI1   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MIFKKHKKHPLKLILYTKLHHydrophilic
NLS Segment(s)
PositionSequence
7-8KK
Subcellular Location(s) nucl 17, mito_nucl 13.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MIFKKHKKHPLKLILYTKLHRREQKNGKKSSTVAFSDACHVISSKLHVLSNLILEGDQFPSQEMKELVDELVKLKRIDVSMGVPLNVIEMLDDGKDFDAIFAEREKEELEERKETIETEKRTNMFYEELSKLDLKLKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.74
4 0.72
5 0.7
6 0.69
7 0.69
8 0.66
9 0.68
10 0.73
11 0.79
12 0.8
13 0.79
14 0.75
15 0.71
16 0.67
17 0.62
18 0.57
19 0.48
20 0.41
21 0.34
22 0.3
23 0.29
24 0.28
25 0.22
26 0.16
27 0.14
28 0.13
29 0.12
30 0.14
31 0.13
32 0.15
33 0.14
34 0.14
35 0.15
36 0.15
37 0.15
38 0.12
39 0.09
40 0.07
41 0.07
42 0.08
43 0.08
44 0.07
45 0.06
46 0.07
47 0.08
48 0.08
49 0.1
50 0.09
51 0.08
52 0.08
53 0.09
54 0.08
55 0.08
56 0.08
57 0.07
58 0.09
59 0.11
60 0.1
61 0.1
62 0.12
63 0.12
64 0.12
65 0.12
66 0.12
67 0.14
68 0.14
69 0.14
70 0.12
71 0.11
72 0.11
73 0.09
74 0.07
75 0.03
76 0.03
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.07
88 0.08
89 0.1
90 0.1
91 0.1
92 0.11
93 0.12
94 0.16
95 0.21
96 0.25
97 0.26
98 0.27
99 0.28
100 0.28
101 0.27
102 0.31
103 0.33
104 0.33
105 0.36
106 0.42
107 0.41
108 0.42
109 0.43
110 0.37
111 0.31
112 0.29
113 0.29
114 0.25
115 0.25
116 0.26
117 0.25
118 0.24