Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GSD0

Protein Details
Accession L2GSD0    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
45-71SSSSGNKKKDEKPPEDKKKEKPKDGGSBasic
155-176KPKDEEKPKDDKKPKDDKKSGDBasic
NLS Segment(s)
PositionSequence
50-77NKKKDEKPPEDKKKEKPKDGGSGGGSGG
154-173EKPKDEEKPKDDKKPKDDKK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, E.R. 2
Family & Domain DBs
Amino Acid Sequences MNFLPYFILLAFIHANMPKELAYEPWESHLAAAADKGSGSNPSGSSSSGNKKKDEKPPEDKKKEKPKDGGSGGGSGGGKPSGNEDPADSKGSEGGDNPNKDKGSQGNKGPEDDKQPEEKPEDEEKPKDEEKPKDEEKPKDEEKPEDEEKPEDEEKPKDEEKPKDDKKPKDDKKSGDQGGGSEEGKGSGVLWNSCCGDDIGLEGGNPQANQNGMNAGMPEIVISLKHAKDENKEQVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.16
4 0.17
5 0.14
6 0.15
7 0.15
8 0.14
9 0.17
10 0.18
11 0.18
12 0.21
13 0.22
14 0.2
15 0.2
16 0.22
17 0.18
18 0.15
19 0.15
20 0.12
21 0.1
22 0.1
23 0.1
24 0.07
25 0.08
26 0.1
27 0.11
28 0.11
29 0.14
30 0.15
31 0.15
32 0.17
33 0.22
34 0.3
35 0.36
36 0.39
37 0.41
38 0.48
39 0.55
40 0.62
41 0.66
42 0.66
43 0.68
44 0.76
45 0.83
46 0.86
47 0.85
48 0.85
49 0.87
50 0.87
51 0.85
52 0.82
53 0.78
54 0.77
55 0.72
56 0.67
57 0.57
58 0.48
59 0.4
60 0.34
61 0.27
62 0.17
63 0.15
64 0.11
65 0.09
66 0.08
67 0.11
68 0.1
69 0.11
70 0.12
71 0.13
72 0.15
73 0.17
74 0.2
75 0.16
76 0.14
77 0.14
78 0.15
79 0.14
80 0.11
81 0.16
82 0.2
83 0.22
84 0.24
85 0.26
86 0.26
87 0.25
88 0.26
89 0.26
90 0.27
91 0.3
92 0.34
93 0.38
94 0.38
95 0.4
96 0.39
97 0.34
98 0.33
99 0.31
100 0.29
101 0.26
102 0.26
103 0.27
104 0.28
105 0.27
106 0.26
107 0.28
108 0.31
109 0.3
110 0.3
111 0.3
112 0.33
113 0.33
114 0.34
115 0.36
116 0.37
117 0.36
118 0.42
119 0.44
120 0.48
121 0.53
122 0.53
123 0.5
124 0.51
125 0.51
126 0.51
127 0.5
128 0.45
129 0.41
130 0.42
131 0.42
132 0.37
133 0.36
134 0.3
135 0.29
136 0.3
137 0.28
138 0.24
139 0.24
140 0.23
141 0.23
142 0.27
143 0.27
144 0.28
145 0.33
146 0.38
147 0.41
148 0.5
149 0.54
150 0.6
151 0.68
152 0.7
153 0.74
154 0.78
155 0.81
156 0.82
157 0.83
158 0.78
159 0.78
160 0.8
161 0.72
162 0.64
163 0.55
164 0.44
165 0.4
166 0.37
167 0.27
168 0.18
169 0.15
170 0.12
171 0.12
172 0.11
173 0.08
174 0.08
175 0.1
176 0.12
177 0.13
178 0.15
179 0.16
180 0.16
181 0.16
182 0.14
183 0.12
184 0.1
185 0.11
186 0.1
187 0.09
188 0.09
189 0.08
190 0.1
191 0.11
192 0.11
193 0.1
194 0.1
195 0.11
196 0.11
197 0.12
198 0.12
199 0.11
200 0.11
201 0.11
202 0.1
203 0.1
204 0.09
205 0.08
206 0.07
207 0.07
208 0.06
209 0.09
210 0.15
211 0.15
212 0.18
213 0.22
214 0.26
215 0.34
216 0.44