Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GWD2

Protein Details
Accession L2GWD2    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
155-180MRSMSDSNRKKRSVKRKRLLEAYNILHydrophilic
NLS Segment(s)
PositionSequence
163-172RKKRSVKRKR
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
Amino Acid Sequences MPLNLEKIEKTITSMDRTYDANFGEWIRNEENCKIIAYHLKKYIMDYPAHDFVVVLKWIVKDWTLRSIIILTKMMIITDLEESLERKMDILQGLIFTWNPVFIAEFVVSVSRMLSNTTKKTFVLGLFEEFEKERIKLVVEQMGNKIEDGIKAVLMRSMSDSNRKKRSVKRKRLLEAYNIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.28
4 0.29
5 0.28
6 0.25
7 0.22
8 0.19
9 0.19
10 0.19
11 0.21
12 0.21
13 0.23
14 0.22
15 0.24
16 0.27
17 0.27
18 0.27
19 0.24
20 0.23
21 0.19
22 0.2
23 0.27
24 0.28
25 0.32
26 0.35
27 0.37
28 0.36
29 0.39
30 0.43
31 0.37
32 0.34
33 0.31
34 0.31
35 0.31
36 0.31
37 0.28
38 0.21
39 0.18
40 0.2
41 0.17
42 0.12
43 0.11
44 0.11
45 0.11
46 0.12
47 0.12
48 0.11
49 0.13
50 0.18
51 0.18
52 0.18
53 0.18
54 0.19
55 0.19
56 0.18
57 0.17
58 0.11
59 0.11
60 0.11
61 0.1
62 0.09
63 0.08
64 0.06
65 0.06
66 0.06
67 0.05
68 0.05
69 0.06
70 0.06
71 0.07
72 0.06
73 0.06
74 0.06
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.05
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.07
96 0.06
97 0.06
98 0.05
99 0.05
100 0.07
101 0.11
102 0.16
103 0.21
104 0.24
105 0.25
106 0.24
107 0.26
108 0.26
109 0.23
110 0.22
111 0.19
112 0.18
113 0.18
114 0.18
115 0.18
116 0.16
117 0.17
118 0.15
119 0.13
120 0.13
121 0.12
122 0.14
123 0.15
124 0.18
125 0.23
126 0.22
127 0.24
128 0.26
129 0.28
130 0.26
131 0.23
132 0.22
133 0.16
134 0.14
135 0.16
136 0.13
137 0.12
138 0.12
139 0.12
140 0.13
141 0.12
142 0.13
143 0.14
144 0.18
145 0.2
146 0.3
147 0.39
148 0.46
149 0.55
150 0.6
151 0.64
152 0.7
153 0.79
154 0.8
155 0.83
156 0.84
157 0.86
158 0.89
159 0.91
160 0.86