Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GU01

Protein Details
Accession L2GU01   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
261-286RPGYSSYRPSYRKRGRKSACQGFSSCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences NGDGNGGNGNGGNGNGNGNGGNGNGNGNGGNGNGDGNGGNGNGNGAAPFSKANGSDKTPAAKNNNNVPTNEPEATGKDEDKVRNEETKGSFGHSYGGYPSKAYASECGSVLFCESSKPRSYESPCITSYPASQCYESSSSCYPTKEPVCPPSYPASQCYESSSSCYPTKEPVCPPSYPASQCYESSSSCYPTKEPVCPPSYPASSCYDGNSNWHAAKESSCSPLYPASQCYDGNSNWNGAKDSSSCGSSSFCASDCFSSCRPGYSSYRPSYRKRGRKSACQGFSSCMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.1
5 0.1
6 0.1
7 0.08
8 0.1
9 0.09
10 0.1
11 0.09
12 0.1
13 0.1
14 0.1
15 0.1
16 0.08
17 0.09
18 0.08
19 0.08
20 0.07
21 0.07
22 0.07
23 0.07
24 0.08
25 0.07
26 0.07
27 0.06
28 0.07
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.07
36 0.08
37 0.1
38 0.11
39 0.15
40 0.18
41 0.22
42 0.26
43 0.28
44 0.31
45 0.32
46 0.37
47 0.41
48 0.44
49 0.45
50 0.51
51 0.57
52 0.54
53 0.53
54 0.5
55 0.47
56 0.46
57 0.41
58 0.32
59 0.25
60 0.25
61 0.28
62 0.26
63 0.22
64 0.2
65 0.24
66 0.26
67 0.29
68 0.31
69 0.3
70 0.33
71 0.34
72 0.37
73 0.34
74 0.35
75 0.31
76 0.29
77 0.27
78 0.22
79 0.23
80 0.17
81 0.15
82 0.14
83 0.17
84 0.14
85 0.14
86 0.14
87 0.12
88 0.13
89 0.13
90 0.13
91 0.13
92 0.14
93 0.14
94 0.14
95 0.13
96 0.12
97 0.12
98 0.1
99 0.07
100 0.09
101 0.1
102 0.13
103 0.16
104 0.18
105 0.19
106 0.26
107 0.31
108 0.37
109 0.39
110 0.4
111 0.38
112 0.38
113 0.37
114 0.3
115 0.29
116 0.24
117 0.24
118 0.2
119 0.2
120 0.18
121 0.21
122 0.22
123 0.19
124 0.19
125 0.16
126 0.18
127 0.2
128 0.2
129 0.18
130 0.21
131 0.23
132 0.24
133 0.26
134 0.28
135 0.3
136 0.29
137 0.31
138 0.3
139 0.32
140 0.29
141 0.29
142 0.27
143 0.26
144 0.26
145 0.27
146 0.24
147 0.2
148 0.22
149 0.21
150 0.2
151 0.2
152 0.2
153 0.18
154 0.21
155 0.23
156 0.24
157 0.26
158 0.28
159 0.3
160 0.29
161 0.31
162 0.3
163 0.32
164 0.29
165 0.29
166 0.27
167 0.26
168 0.26
169 0.27
170 0.24
171 0.2
172 0.22
173 0.21
174 0.2
175 0.2
176 0.2
177 0.18
178 0.21
179 0.23
180 0.24
181 0.26
182 0.28
183 0.3
184 0.29
185 0.31
186 0.32
187 0.33
188 0.29
189 0.29
190 0.28
191 0.28
192 0.28
193 0.28
194 0.24
195 0.21
196 0.24
197 0.25
198 0.23
199 0.21
200 0.21
201 0.21
202 0.19
203 0.2
204 0.2
205 0.2
206 0.21
207 0.21
208 0.2
209 0.2
210 0.24
211 0.26
212 0.24
213 0.24
214 0.22
215 0.24
216 0.24
217 0.26
218 0.26
219 0.23
220 0.26
221 0.25
222 0.25
223 0.24
224 0.25
225 0.24
226 0.2
227 0.22
228 0.18
229 0.21
230 0.2
231 0.19
232 0.18
233 0.17
234 0.19
235 0.17
236 0.19
237 0.16
238 0.15
239 0.16
240 0.18
241 0.2
242 0.21
243 0.26
244 0.24
245 0.29
246 0.29
247 0.3
248 0.3
249 0.33
250 0.37
251 0.41
252 0.49
253 0.51
254 0.61
255 0.64
256 0.69
257 0.74
258 0.78
259 0.79
260 0.79
261 0.83
262 0.81
263 0.86
264 0.89
265 0.89
266 0.86
267 0.8
268 0.73