Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GXJ2

Protein Details
Accession L2GXJ2    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-33APKMYVKSNSRYKKKTERWHHITRCINQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14mito_nucl 14, mito 12
Family & Domain DBs
Amino Acid Sequences MRKYNAPKMYVKSNSRYKKKTERWHHITRCINQSCNYYTVNTICFAFHANVKSTFWLYSCIPKKTTPNFASAGYRWRRLCLHTCCQMYFNLDIAQEPVVNEVLQIFFLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.74
3 0.75
4 0.74
5 0.76
6 0.8
7 0.82
8 0.83
9 0.84
10 0.82
11 0.88
12 0.86
13 0.85
14 0.83
15 0.78
16 0.77
17 0.7
18 0.64
19 0.56
20 0.53
21 0.46
22 0.4
23 0.34
24 0.25
25 0.23
26 0.21
27 0.19
28 0.16
29 0.14
30 0.11
31 0.11
32 0.11
33 0.1
34 0.11
35 0.12
36 0.13
37 0.14
38 0.14
39 0.15
40 0.14
41 0.14
42 0.12
43 0.13
44 0.11
45 0.19
46 0.24
47 0.25
48 0.26
49 0.29
50 0.36
51 0.38
52 0.47
53 0.4
54 0.39
55 0.38
56 0.38
57 0.39
58 0.33
59 0.38
60 0.31
61 0.36
62 0.33
63 0.34
64 0.34
65 0.35
66 0.43
67 0.42
68 0.45
69 0.48
70 0.5
71 0.48
72 0.48
73 0.44
74 0.38
75 0.32
76 0.27
77 0.21
78 0.18
79 0.17
80 0.17
81 0.16
82 0.14
83 0.12
84 0.12
85 0.1
86 0.1
87 0.1
88 0.1
89 0.09