Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GRH6

Protein Details
Accession L2GRH6   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
50-76SYYTPVKRSGRRKRRSICDRNRVNKAHHydrophilic
NLS Segment(s)
PositionSequence
56-64KRSGRRKRR
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSKKSEKDDVVQICNDPYDDFAVIYKGHKYTLRPKYDIFTDLVGEKELYSYYTPVKRSGRRKRRSICDRNRVNKAHIDKLLSTVCDVPPPNRPGDECSLPSKDQKQHSDLVADAQLFLNCIKRMRMKHGASKREN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.29
3 0.2
4 0.16
5 0.14
6 0.12
7 0.12
8 0.11
9 0.12
10 0.12
11 0.13
12 0.15
13 0.13
14 0.16
15 0.18
16 0.22
17 0.31
18 0.4
19 0.46
20 0.46
21 0.46
22 0.47
23 0.48
24 0.45
25 0.36
26 0.27
27 0.21
28 0.19
29 0.18
30 0.15
31 0.12
32 0.1
33 0.09
34 0.08
35 0.08
36 0.08
37 0.08
38 0.12
39 0.16
40 0.17
41 0.23
42 0.29
43 0.36
44 0.46
45 0.56
46 0.63
47 0.67
48 0.76
49 0.79
50 0.83
51 0.86
52 0.87
53 0.86
54 0.85
55 0.87
56 0.84
57 0.83
58 0.74
59 0.66
60 0.61
61 0.55
62 0.5
63 0.43
64 0.38
65 0.3
66 0.32
67 0.3
68 0.24
69 0.2
70 0.16
71 0.14
72 0.16
73 0.16
74 0.15
75 0.21
76 0.23
77 0.24
78 0.24
79 0.25
80 0.26
81 0.31
82 0.33
83 0.28
84 0.31
85 0.33
86 0.33
87 0.37
88 0.4
89 0.41
90 0.44
91 0.47
92 0.46
93 0.46
94 0.46
95 0.43
96 0.36
97 0.33
98 0.27
99 0.22
100 0.19
101 0.16
102 0.14
103 0.13
104 0.13
105 0.15
106 0.15
107 0.17
108 0.21
109 0.27
110 0.32
111 0.4
112 0.5
113 0.52
114 0.61
115 0.69