Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GTY7

Protein Details
Accession L2GTY7    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
115-143HKYFNRKYYDLKERYKRVCRRARKFALYEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.5, nucl 14, cyto 13
Family & Domain DBs
Amino Acid Sequences VFVAINSEEVLKKQQEVAQEKSIILRLYKNCCKSFKCDILHYKIRNKENTELYKHCKYYFLIKFIILHSYDELVSSIDLKLIVSDEKLFLYLLEKVIDDSDLVRARKMLMFAKKHKYFNRKYYDLKERYKRVCRRARKFALYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.29
3 0.35
4 0.39
5 0.4
6 0.4
7 0.39
8 0.38
9 0.39
10 0.31
11 0.26
12 0.27
13 0.26
14 0.34
15 0.42
16 0.47
17 0.49
18 0.53
19 0.55
20 0.55
21 0.59
22 0.58
23 0.55
24 0.56
25 0.59
26 0.62
27 0.67
28 0.66
29 0.64
30 0.63
31 0.65
32 0.63
33 0.6
34 0.58
35 0.58
36 0.59
37 0.57
38 0.55
39 0.55
40 0.55
41 0.52
42 0.46
43 0.4
44 0.35
45 0.38
46 0.38
47 0.34
48 0.29
49 0.28
50 0.29
51 0.27
52 0.28
53 0.19
54 0.15
55 0.11
56 0.11
57 0.1
58 0.09
59 0.09
60 0.06
61 0.06
62 0.06
63 0.05
64 0.05
65 0.05
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.06
72 0.06
73 0.06
74 0.07
75 0.06
76 0.06
77 0.07
78 0.08
79 0.08
80 0.09
81 0.08
82 0.08
83 0.09
84 0.09
85 0.07
86 0.07
87 0.11
88 0.15
89 0.16
90 0.16
91 0.16
92 0.17
93 0.19
94 0.21
95 0.23
96 0.27
97 0.34
98 0.42
99 0.52
100 0.58
101 0.64
102 0.7
103 0.73
104 0.74
105 0.76
106 0.78
107 0.74
108 0.75
109 0.76
110 0.79
111 0.77
112 0.78
113 0.78
114 0.78
115 0.81
116 0.84
117 0.84
118 0.84
119 0.86
120 0.87
121 0.87
122 0.89
123 0.89