Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GRW0

Protein Details
Accession L2GRW0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
81-109IDSPSICNKKICKKQKKAKKIKKRKKILKBasic
NLS Segment(s)
PositionSequence
93-109KKQKKAKKIKKRKKILK
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
Amino Acid Sequences METWIDKMKSGEKVTSIKKEVEEFKRKCALEKAQAKISATLKKQVQVTMPNYERRHCIVVQKNTMPFSFGETNAKETKKQIDSPSICNKKICKKQKKAKKIKKRKKILK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.5
3 0.47
4 0.43
5 0.42
6 0.45
7 0.49
8 0.52
9 0.56
10 0.49
11 0.53
12 0.58
13 0.56
14 0.54
15 0.53
16 0.5
17 0.5
18 0.56
19 0.53
20 0.51
21 0.53
22 0.51
23 0.48
24 0.45
25 0.41
26 0.35
27 0.36
28 0.32
29 0.33
30 0.33
31 0.3
32 0.29
33 0.29
34 0.31
35 0.32
36 0.34
37 0.38
38 0.38
39 0.38
40 0.37
41 0.33
42 0.33
43 0.26
44 0.31
45 0.32
46 0.38
47 0.42
48 0.43
49 0.43
50 0.41
51 0.4
52 0.33
53 0.25
54 0.23
55 0.2
56 0.18
57 0.21
58 0.2
59 0.24
60 0.28
61 0.29
62 0.25
63 0.25
64 0.31
65 0.31
66 0.36
67 0.36
68 0.41
69 0.44
70 0.5
71 0.58
72 0.58
73 0.55
74 0.54
75 0.57
76 0.57
77 0.64
78 0.68
79 0.68
80 0.72
81 0.81
82 0.88
83 0.93
84 0.94
85 0.95
86 0.95
87 0.96
88 0.96
89 0.96