Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GRN9

Protein Details
Accession L2GRN9   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
75-100VSPSICNKKICKKQKKAKKILKLTKTHydrophilic
NLS Segment(s)
PositionSequence
86-97KKQKKAKKILKL
Subcellular Location(s) nucl 17.5, cyto_nucl 14.333, mito_nucl 9.666, cyto 9
Family & Domain DBs
Amino Acid Sequences MDSGEKITSIKKEVEEFKRKCALEKAQAKISATLKKQVQVTMPNYERRHCVVVQKNPVPVSFGETKAKETKKQIVSPSICNKKICKKQKKAKKILKLTKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.53
3 0.52
4 0.55
5 0.6
6 0.58
7 0.56
8 0.55
9 0.52
10 0.52
11 0.58
12 0.56
13 0.54
14 0.56
15 0.53
16 0.5
17 0.47
18 0.43
19 0.37
20 0.38
21 0.34
22 0.35
23 0.35
24 0.32
25 0.31
26 0.31
27 0.32
28 0.34
29 0.36
30 0.4
31 0.4
32 0.39
33 0.38
34 0.34
35 0.34
36 0.27
37 0.32
38 0.32
39 0.38
40 0.45
41 0.45
42 0.45
43 0.43
44 0.42
45 0.35
46 0.27
47 0.25
48 0.2
49 0.2
50 0.22
51 0.22
52 0.26
53 0.32
54 0.35
55 0.35
56 0.37
57 0.44
58 0.45
59 0.5
60 0.52
61 0.54
62 0.55
63 0.58
64 0.63
65 0.63
66 0.6
67 0.58
68 0.59
69 0.6
70 0.67
71 0.7
72 0.71
73 0.73
74 0.8
75 0.88
76 0.93
77 0.94
78 0.94
79 0.94
80 0.94