Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GT81

Protein Details
Accession L2GT81    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
156-175DEYKKLLVRKERKTINRGSYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR042448  CCNB1IP1  
Gene Ontology GO:0000795  C:synaptonemal complex  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0007131  P:reciprocal meiotic recombination  
Amino Acid Sequences MHLKCNNLRCRSTIQKYILITPCSHVYCETCSPKIENMQICVACKTMVRKDELLVRELTKPPSIVGYPPDDVLECARDAISFWMYQAQQQEYIMKTMLEKAHSDAYKAVQHLKTCKLSAAIEKENMKSCIKKLENSLKREKENVYDLNMMLREKTDEYKKLLVRKERKTINRGSYESTYEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.58
3 0.58
4 0.63
5 0.6
6 0.52
7 0.45
8 0.39
9 0.4
10 0.35
11 0.34
12 0.27
13 0.23
14 0.25
15 0.33
16 0.35
17 0.31
18 0.32
19 0.34
20 0.36
21 0.39
22 0.4
23 0.35
24 0.33
25 0.37
26 0.36
27 0.35
28 0.32
29 0.27
30 0.21
31 0.2
32 0.22
33 0.22
34 0.24
35 0.27
36 0.27
37 0.28
38 0.35
39 0.34
40 0.31
41 0.27
42 0.26
43 0.26
44 0.28
45 0.28
46 0.22
47 0.21
48 0.19
49 0.19
50 0.18
51 0.15
52 0.15
53 0.17
54 0.16
55 0.16
56 0.16
57 0.14
58 0.14
59 0.13
60 0.12
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.08
67 0.08
68 0.07
69 0.07
70 0.1
71 0.1
72 0.12
73 0.14
74 0.13
75 0.13
76 0.13
77 0.15
78 0.12
79 0.13
80 0.11
81 0.09
82 0.08
83 0.11
84 0.12
85 0.12
86 0.12
87 0.13
88 0.18
89 0.18
90 0.19
91 0.16
92 0.18
93 0.19
94 0.2
95 0.23
96 0.2
97 0.22
98 0.25
99 0.3
100 0.3
101 0.28
102 0.28
103 0.24
104 0.23
105 0.27
106 0.29
107 0.27
108 0.28
109 0.3
110 0.32
111 0.34
112 0.35
113 0.32
114 0.27
115 0.26
116 0.32
117 0.32
118 0.33
119 0.38
120 0.46
121 0.51
122 0.56
123 0.65
124 0.62
125 0.63
126 0.64
127 0.57
128 0.51
129 0.51
130 0.46
131 0.4
132 0.36
133 0.33
134 0.33
135 0.32
136 0.27
137 0.2
138 0.18
139 0.16
140 0.16
141 0.22
142 0.26
143 0.28
144 0.33
145 0.41
146 0.45
147 0.5
148 0.56
149 0.6
150 0.63
151 0.68
152 0.72
153 0.75
154 0.79
155 0.79
156 0.8
157 0.79
158 0.78
159 0.72
160 0.69
161 0.63