Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GRU5

Protein Details
Accession L2GRU5    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
62-84NGRRVNGKPLKIRKGRNSPLRIDHydrophilic
NLS Segment(s)
PositionSequence
65-77RVNGKPLKIRKGR
Subcellular Location(s) mito_nucl 11.999, mito 11.5, nucl 11, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd00590  RRM_SF  
Amino Acid Sequences MVYILHISSLSPLTTKDHLQQLLPYKSITSIKIMQRKGRSRCYGFIELMNGDEFVEIIEKFNGRRVNGKPLKIRKGRNSPLRID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.22
4 0.27
5 0.28
6 0.28
7 0.32
8 0.37
9 0.37
10 0.36
11 0.31
12 0.25
13 0.27
14 0.28
15 0.24
16 0.19
17 0.22
18 0.28
19 0.35
20 0.38
21 0.41
22 0.48
23 0.56
24 0.57
25 0.6
26 0.6
27 0.56
28 0.57
29 0.57
30 0.52
31 0.44
32 0.39
33 0.32
34 0.25
35 0.22
36 0.18
37 0.12
38 0.08
39 0.07
40 0.06
41 0.04
42 0.06
43 0.05
44 0.06
45 0.07
46 0.08
47 0.08
48 0.14
49 0.18
50 0.18
51 0.25
52 0.27
53 0.38
54 0.44
55 0.51
56 0.55
57 0.61
58 0.71
59 0.72
60 0.78
61 0.77
62 0.82
63 0.85
64 0.85