Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GWZ5

Protein Details
Accession L2GWZ5    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-37PQIYNNPKNTEKKRYFKKVGYGIHydrophilic
82-107IKKYFFYVKKYKRYERRQKKFAVHLPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR032440  Ribosomal_S11_N  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
PF16205  Ribosomal_S17_N  
Amino Acid Sequences MVETLTKFKIYPQQPQIYNNPKNTEKKRYFKKVGYGITVPETAINGTYIDKNCPFTGSVRLYGKFVKAEVLKMKQIRTIICIKKYFFYVKKYKRYERRQKKFAVHLPPCFEGLVNVGDIVNCALVRPLSKTKRFVVVGVENKIVPEKKYKTLEDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.6
3 0.66
4 0.68
5 0.7
6 0.66
7 0.64
8 0.62
9 0.69
10 0.71
11 0.72
12 0.71
13 0.74
14 0.78
15 0.81
16 0.82
17 0.78
18 0.8
19 0.78
20 0.73
21 0.68
22 0.59
23 0.51
24 0.45
25 0.4
26 0.3
27 0.22
28 0.17
29 0.12
30 0.11
31 0.09
32 0.07
33 0.08
34 0.11
35 0.12
36 0.15
37 0.16
38 0.18
39 0.18
40 0.19
41 0.18
42 0.16
43 0.23
44 0.22
45 0.26
46 0.26
47 0.27
48 0.27
49 0.27
50 0.27
51 0.2
52 0.18
53 0.17
54 0.14
55 0.17
56 0.2
57 0.22
58 0.25
59 0.27
60 0.27
61 0.25
62 0.26
63 0.23
64 0.22
65 0.28
66 0.28
67 0.31
68 0.33
69 0.31
70 0.3
71 0.33
72 0.36
73 0.31
74 0.35
75 0.4
76 0.46
77 0.55
78 0.62
79 0.68
80 0.72
81 0.8
82 0.84
83 0.85
84 0.86
85 0.84
86 0.85
87 0.83
88 0.82
89 0.79
90 0.78
91 0.73
92 0.68
93 0.64
94 0.58
95 0.51
96 0.41
97 0.33
98 0.23
99 0.18
100 0.14
101 0.1
102 0.08
103 0.07
104 0.07
105 0.07
106 0.07
107 0.06
108 0.05
109 0.05
110 0.05
111 0.06
112 0.08
113 0.13
114 0.22
115 0.3
116 0.37
117 0.42
118 0.44
119 0.52
120 0.52
121 0.48
122 0.46
123 0.47
124 0.48
125 0.47
126 0.46
127 0.37
128 0.37
129 0.41
130 0.35
131 0.28
132 0.31
133 0.32
134 0.39
135 0.46