Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GST4

Protein Details
Accession L2GST4   
Localization Confidence High
Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MLTVKEEKRRKRLKNLEKQRLIRRHTLBasic
48-70IVRNPKFKKCRFGRKYRNYVFMEHydrophilic
NLS Segment(s)
PositionSequence
7-25EKRRKRLKNLEKQRLIRRH
35-37KSK
40-43NRKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MLTVKEEKRRKRLKNLEKQRLIRRHTLLDIPFPPKSKVLNRKKNFLMIVRNPKFKKCRFGRKYRNYVFMEGDKRALKDMKRNYGTNLVHYEERAKMFGEYEVIEELADDLEGYRRYIDTDTFRYGEHNQAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.92
4 0.92
5 0.92
6 0.91
7 0.88
8 0.82
9 0.79
10 0.72
11 0.66
12 0.59
13 0.57
14 0.49
15 0.46
16 0.45
17 0.42
18 0.4
19 0.37
20 0.36
21 0.32
22 0.35
23 0.38
24 0.44
25 0.51
26 0.59
27 0.6
28 0.66
29 0.66
30 0.67
31 0.6
32 0.55
33 0.53
34 0.5
35 0.58
36 0.55
37 0.61
38 0.56
39 0.6
40 0.63
41 0.58
42 0.59
43 0.57
44 0.64
45 0.64
46 0.74
47 0.78
48 0.8
49 0.87
50 0.81
51 0.81
52 0.72
53 0.65
54 0.57
55 0.51
56 0.44
57 0.34
58 0.33
59 0.25
60 0.23
61 0.23
62 0.24
63 0.2
64 0.26
65 0.32
66 0.38
67 0.42
68 0.42
69 0.43
70 0.49
71 0.48
72 0.43
73 0.39
74 0.32
75 0.28
76 0.28
77 0.28
78 0.21
79 0.22
80 0.19
81 0.16
82 0.14
83 0.14
84 0.14
85 0.13
86 0.11
87 0.11
88 0.11
89 0.1
90 0.09
91 0.08
92 0.08
93 0.06
94 0.06
95 0.04
96 0.04
97 0.08
98 0.09
99 0.1
100 0.1
101 0.1
102 0.12
103 0.14
104 0.19
105 0.22
106 0.27
107 0.31
108 0.31
109 0.31
110 0.34
111 0.35