Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GRJ8

Protein Details
Accession L2GRJ8   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
28-53SESMRKIKEVKYTRKEQKERLNHDVHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013255  Spc25_C  
Gene Ontology GO:0031262  C:Ndc80 complex  
GO:0005634  C:nucleus  
GO:0051301  P:cell division  
GO:0007059  P:chromosome segregation  
Pfam View protein in Pfam  
PF08234  Spindle_Spc25  
Amino Acid Sequences MTSRELTNLHEIQSITSGLRKKFAHLLSESMRKIKEVKYTRKEQKERLNHDVHTIRTEIKKNEEEIKHLRNSLEKLERTLDRERNELSDAQRENDSLYKQVAEHEENKKNLARLTSEIERRVLGLRAQRTNEMRSTETNEKRLESGASQYRKALGINITQICDNMLKIEFFNFDETDLGGYIVMDFKDDTESVTEVWPCVVSLEKINLVLNISDDFYDFLKRVRGIFHDSIKEDVCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.17
3 0.2
4 0.24
5 0.22
6 0.29
7 0.28
8 0.3
9 0.37
10 0.39
11 0.41
12 0.37
13 0.42
14 0.42
15 0.5
16 0.48
17 0.44
18 0.41
19 0.36
20 0.38
21 0.36
22 0.4
23 0.41
24 0.5
25 0.55
26 0.65
27 0.74
28 0.81
29 0.84
30 0.82
31 0.83
32 0.83
33 0.83
34 0.81
35 0.76
36 0.66
37 0.67
38 0.62
39 0.53
40 0.45
41 0.38
42 0.33
43 0.33
44 0.38
45 0.33
46 0.36
47 0.37
48 0.38
49 0.46
50 0.43
51 0.44
52 0.45
53 0.48
54 0.44
55 0.42
56 0.4
57 0.35
58 0.36
59 0.37
60 0.38
61 0.33
62 0.33
63 0.35
64 0.36
65 0.36
66 0.42
67 0.4
68 0.34
69 0.36
70 0.35
71 0.33
72 0.33
73 0.31
74 0.26
75 0.27
76 0.26
77 0.24
78 0.24
79 0.22
80 0.21
81 0.21
82 0.19
83 0.14
84 0.13
85 0.12
86 0.12
87 0.14
88 0.16
89 0.16
90 0.21
91 0.28
92 0.32
93 0.32
94 0.35
95 0.34
96 0.32
97 0.3
98 0.25
99 0.2
100 0.16
101 0.21
102 0.24
103 0.25
104 0.25
105 0.24
106 0.23
107 0.22
108 0.21
109 0.17
110 0.14
111 0.16
112 0.2
113 0.22
114 0.24
115 0.27
116 0.28
117 0.3
118 0.3
119 0.28
120 0.25
121 0.23
122 0.29
123 0.34
124 0.35
125 0.37
126 0.35
127 0.33
128 0.32
129 0.31
130 0.26
131 0.17
132 0.2
133 0.23
134 0.25
135 0.25
136 0.25
137 0.25
138 0.25
139 0.24
140 0.2
141 0.15
142 0.15
143 0.2
144 0.21
145 0.2
146 0.2
147 0.2
148 0.18
149 0.16
150 0.13
151 0.09
152 0.09
153 0.09
154 0.09
155 0.1
156 0.1
157 0.11
158 0.14
159 0.12
160 0.12
161 0.12
162 0.12
163 0.11
164 0.1
165 0.09
166 0.06
167 0.06
168 0.05
169 0.07
170 0.06
171 0.06
172 0.06
173 0.06
174 0.09
175 0.09
176 0.1
177 0.1
178 0.11
179 0.11
180 0.14
181 0.14
182 0.11
183 0.12
184 0.11
185 0.09
186 0.09
187 0.1
188 0.09
189 0.12
190 0.15
191 0.16
192 0.17
193 0.17
194 0.17
195 0.17
196 0.16
197 0.14
198 0.12
199 0.12
200 0.1
201 0.1
202 0.11
203 0.11
204 0.13
205 0.12
206 0.13
207 0.18
208 0.19
209 0.2
210 0.23
211 0.27
212 0.32
213 0.38
214 0.44
215 0.45
216 0.46
217 0.48