Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GU96

Protein Details
Accession L2GU96    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
88-121REGMAKKDKEARRVRKDKRKRRVASWGSARRQEKBasic
NLS Segment(s)
PositionSequence
92-128AKKDKEARRVRKDKRKRRVASWGSARRQEKKAERKQK
Subcellular Location(s) nucl 19, mito 5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MALDIQTLAHFNNRLLNRQELTLLVSHPAQSFKKADLATVLKKKYNSNYVIIHGSRTEFGTCQTRTVARIYESKEQFEKIEDWFVLIREGMAKKDKEARRVRKDKRKRRVASWGSARRQEKKAERKQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.36
4 0.33
5 0.33
6 0.33
7 0.26
8 0.26
9 0.21
10 0.18
11 0.14
12 0.13
13 0.14
14 0.14
15 0.18
16 0.17
17 0.19
18 0.2
19 0.2
20 0.26
21 0.24
22 0.23
23 0.24
24 0.28
25 0.32
26 0.37
27 0.38
28 0.35
29 0.37
30 0.41
31 0.41
32 0.44
33 0.39
34 0.36
35 0.36
36 0.36
37 0.38
38 0.35
39 0.3
40 0.23
41 0.2
42 0.16
43 0.15
44 0.13
45 0.08
46 0.1
47 0.15
48 0.15
49 0.15
50 0.16
51 0.15
52 0.16
53 0.18
54 0.17
55 0.13
56 0.17
57 0.2
58 0.28
59 0.28
60 0.29
61 0.29
62 0.28
63 0.27
64 0.25
65 0.22
66 0.15
67 0.17
68 0.14
69 0.14
70 0.14
71 0.14
72 0.12
73 0.11
74 0.09
75 0.1
76 0.11
77 0.13
78 0.18
79 0.18
80 0.2
81 0.3
82 0.34
83 0.4
84 0.5
85 0.58
86 0.63
87 0.74
88 0.82
89 0.84
90 0.91
91 0.92
92 0.93
93 0.93
94 0.89
95 0.86
96 0.87
97 0.84
98 0.83
99 0.83
100 0.82
101 0.78
102 0.8
103 0.78
104 0.74
105 0.71
106 0.71
107 0.7
108 0.71