Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GTN1

Protein Details
Accession L2GTN1    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
89-114AMTLKSKKRLSQVKKRKSESKNIVDAHydrophilic
NLS Segment(s)
PositionSequence
95-105KKRLSQVKKRK
Subcellular Location(s) nucl 25.5, mito_nucl 13.5
Family & Domain DBs
Amino Acid Sequences CLRRDESQNTYHGSISYLQHYKQTHGYMFQDINNDRPSTKKLFKVIDFIWNQHELRKLENIRRMLLDCDDSAINNHFVELKAVLMKFTAMTLKSKKRLSQVKKRKSESKNIVDAISEHMKETYHNTIKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.28
4 0.26
5 0.25
6 0.3
7 0.31
8 0.33
9 0.34
10 0.36
11 0.3
12 0.31
13 0.33
14 0.31
15 0.32
16 0.3
17 0.32
18 0.28
19 0.31
20 0.29
21 0.28
22 0.23
23 0.24
24 0.27
25 0.28
26 0.32
27 0.33
28 0.36
29 0.41
30 0.42
31 0.45
32 0.42
33 0.43
34 0.39
35 0.36
36 0.33
37 0.31
38 0.3
39 0.26
40 0.3
41 0.22
42 0.23
43 0.29
44 0.29
45 0.32
46 0.38
47 0.37
48 0.32
49 0.33
50 0.32
51 0.26
52 0.23
53 0.19
54 0.13
55 0.12
56 0.11
57 0.1
58 0.1
59 0.1
60 0.1
61 0.08
62 0.09
63 0.08
64 0.08
65 0.09
66 0.08
67 0.07
68 0.08
69 0.09
70 0.09
71 0.08
72 0.08
73 0.07
74 0.07
75 0.09
76 0.08
77 0.13
78 0.2
79 0.28
80 0.35
81 0.39
82 0.42
83 0.49
84 0.58
85 0.63
86 0.68
87 0.72
88 0.76
89 0.82
90 0.85
91 0.86
92 0.83
93 0.84
94 0.83
95 0.81
96 0.78
97 0.7
98 0.63
99 0.53
100 0.47
101 0.43
102 0.38
103 0.3
104 0.22
105 0.21
106 0.21
107 0.21
108 0.26
109 0.3