Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GS08

Protein Details
Accession L2GS08   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
370-389LWDDVIKRVKKFKKLKNLFAHydrophilic
NLS Segment(s)
PositionSequence
380-380K
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004583  DNA_repair_Rad4  
IPR018326  Rad4_beta-hairpin_dom1  
IPR042488  Rad4_BHD3_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003684  F:damaged DNA binding  
GO:0006289  P:nucleotide-excision repair  
Pfam View protein in Pfam  
PF10403  BHD_1  
Amino Acid Sequences MVSSDSWCSVSSEKDEIFDQEKQTKIRISQNKIRVGLFVRLLRIFKAIVARFDYKPIETNKFLEYKRLCASEPDKITIFKKLVFMGIPCRLYLIINDDTEFVVEAFMAEIIENFRLSKTGLICYIGVDGSFVNTTILNSTKFKHFGIFDTLISGMKEVIREHRFFLEARHRLSKMGVVLPAEFDESFLFSKVPKSLRNLKYHPLYTIESNIRKNQIIFPKRPILGYFKGEPIFYKKNVQILRSEREWFRLGKRASRPIYKMVNGVKLYRKYDVEDIVIEDLEGKPMLYYHNNHIPRNCIYSKNDFSVCVAKLLDIRFSECIVGFKYKMPVYQGIFLYKKDASLFFNTLEQYKFNKMIVDTVEKGDRIYRLWDDVIKRVKKFKKLKNLFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.28
4 0.31
5 0.32
6 0.33
7 0.34
8 0.38
9 0.39
10 0.42
11 0.43
12 0.43
13 0.49
14 0.54
15 0.56
16 0.61
17 0.68
18 0.72
19 0.7
20 0.65
21 0.58
22 0.53
23 0.49
24 0.45
25 0.4
26 0.36
27 0.36
28 0.36
29 0.33
30 0.31
31 0.25
32 0.22
33 0.28
34 0.26
35 0.26
36 0.31
37 0.35
38 0.34
39 0.38
40 0.38
41 0.31
42 0.35
43 0.37
44 0.38
45 0.36
46 0.38
47 0.37
48 0.42
49 0.41
50 0.44
51 0.4
52 0.39
53 0.41
54 0.41
55 0.37
56 0.38
57 0.42
58 0.41
59 0.43
60 0.4
61 0.37
62 0.38
63 0.39
64 0.38
65 0.35
66 0.28
67 0.28
68 0.25
69 0.25
70 0.23
71 0.24
72 0.24
73 0.29
74 0.27
75 0.24
76 0.24
77 0.22
78 0.21
79 0.21
80 0.2
81 0.17
82 0.17
83 0.17
84 0.17
85 0.17
86 0.17
87 0.16
88 0.1
89 0.06
90 0.05
91 0.05
92 0.04
93 0.04
94 0.04
95 0.03
96 0.04
97 0.05
98 0.06
99 0.06
100 0.06
101 0.06
102 0.07
103 0.08
104 0.11
105 0.11
106 0.13
107 0.13
108 0.15
109 0.15
110 0.14
111 0.15
112 0.11
113 0.1
114 0.08
115 0.07
116 0.06
117 0.06
118 0.06
119 0.05
120 0.05
121 0.06
122 0.07
123 0.09
124 0.1
125 0.11
126 0.13
127 0.17
128 0.19
129 0.19
130 0.21
131 0.2
132 0.2
133 0.26
134 0.26
135 0.22
136 0.21
137 0.21
138 0.19
139 0.17
140 0.15
141 0.08
142 0.07
143 0.08
144 0.08
145 0.15
146 0.18
147 0.19
148 0.21
149 0.22
150 0.22
151 0.22
152 0.27
153 0.29
154 0.29
155 0.32
156 0.35
157 0.34
158 0.33
159 0.34
160 0.3
161 0.22
162 0.2
163 0.18
164 0.14
165 0.14
166 0.13
167 0.13
168 0.12
169 0.09
170 0.07
171 0.06
172 0.07
173 0.07
174 0.07
175 0.07
176 0.06
177 0.08
178 0.11
179 0.14
180 0.15
181 0.21
182 0.31
183 0.38
184 0.45
185 0.46
186 0.49
187 0.52
188 0.5
189 0.46
190 0.39
191 0.33
192 0.27
193 0.29
194 0.29
195 0.27
196 0.29
197 0.3
198 0.29
199 0.28
200 0.28
201 0.29
202 0.33
203 0.36
204 0.36
205 0.39
206 0.43
207 0.43
208 0.43
209 0.38
210 0.35
211 0.32
212 0.33
213 0.29
214 0.27
215 0.27
216 0.26
217 0.25
218 0.26
219 0.26
220 0.24
221 0.28
222 0.26
223 0.32
224 0.35
225 0.35
226 0.35
227 0.37
228 0.4
229 0.38
230 0.4
231 0.34
232 0.35
233 0.36
234 0.31
235 0.29
236 0.33
237 0.32
238 0.36
239 0.42
240 0.47
241 0.5
242 0.54
243 0.54
244 0.52
245 0.56
246 0.5
247 0.49
248 0.44
249 0.46
250 0.41
251 0.42
252 0.42
253 0.41
254 0.42
255 0.39
256 0.37
257 0.32
258 0.34
259 0.32
260 0.27
261 0.22
262 0.21
263 0.19
264 0.17
265 0.14
266 0.11
267 0.09
268 0.08
269 0.08
270 0.06
271 0.05
272 0.06
273 0.09
274 0.13
275 0.15
276 0.21
277 0.3
278 0.36
279 0.38
280 0.4
281 0.42
282 0.4
283 0.44
284 0.41
285 0.37
286 0.37
287 0.44
288 0.46
289 0.46
290 0.45
291 0.38
292 0.38
293 0.38
294 0.34
295 0.27
296 0.23
297 0.19
298 0.21
299 0.22
300 0.23
301 0.18
302 0.2
303 0.19
304 0.19
305 0.2
306 0.17
307 0.18
308 0.17
309 0.2
310 0.18
311 0.2
312 0.26
313 0.26
314 0.27
315 0.29
316 0.33
317 0.32
318 0.37
319 0.36
320 0.37
321 0.37
322 0.36
323 0.36
324 0.3
325 0.29
326 0.25
327 0.25
328 0.22
329 0.26
330 0.28
331 0.25
332 0.28
333 0.28
334 0.28
335 0.27
336 0.26
337 0.24
338 0.27
339 0.29
340 0.26
341 0.29
342 0.26
343 0.3
344 0.32
345 0.35
346 0.31
347 0.33
348 0.35
349 0.32
350 0.32
351 0.31
352 0.28
353 0.23
354 0.26
355 0.25
356 0.25
357 0.28
358 0.33
359 0.33
360 0.4
361 0.48
362 0.5
363 0.52
364 0.58
365 0.63
366 0.68
367 0.74
368 0.76
369 0.78