Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GS90

Protein Details
Accession L2GS90   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
62-100LNDPEAEERRRKRRRERNRRYRQRKKNRKKAAASVSLRTBasic
NLS Segment(s)
PositionSequence
70-92RRRKRRRERNRRYRQRKKNRKKA
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MATKQPDIYDLAFQSDETEDLFDESEVEQLSQTDVDLYLAEQHDRMVISNAVYLVYSPPPELNDPEAEERRRKRRRERNRRYRQRKKNRKKAAASVSLRTNTSDVIKQANEYPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.16
4 0.12
5 0.12
6 0.08
7 0.09
8 0.1
9 0.07
10 0.08
11 0.08
12 0.09
13 0.08
14 0.08
15 0.07
16 0.07
17 0.08
18 0.07
19 0.07
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.08
26 0.08
27 0.09
28 0.08
29 0.08
30 0.09
31 0.09
32 0.09
33 0.08
34 0.08
35 0.08
36 0.08
37 0.08
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.09
48 0.1
49 0.11
50 0.11
51 0.13
52 0.18
53 0.22
54 0.23
55 0.29
56 0.35
57 0.44
58 0.52
59 0.58
60 0.65
61 0.72
62 0.81
63 0.85
64 0.9
65 0.91
66 0.94
67 0.97
68 0.97
69 0.97
70 0.97
71 0.97
72 0.97
73 0.97
74 0.96
75 0.96
76 0.95
77 0.92
78 0.91
79 0.89
80 0.88
81 0.81
82 0.75
83 0.71
84 0.63
85 0.55
86 0.47
87 0.38
88 0.29
89 0.28
90 0.27
91 0.22
92 0.24
93 0.24
94 0.25