Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GYG0

Protein Details
Accession L2GYG0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21LRSRRSHRSHSKLRWTPFRLMHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, mito 5, E.R. 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences LRSRRSHRSHSKLRWTPFRLMISAILLAVSVGFIIYVLIPFIEGFIELQNFANLLFVILHVFYMFNVATLKKKSQWVFWVASYLILDAASILFVFYDSIFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.8
3 0.77
4 0.73
5 0.66
6 0.55
7 0.48
8 0.41
9 0.32
10 0.27
11 0.2
12 0.13
13 0.09
14 0.08
15 0.06
16 0.05
17 0.03
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.03
25 0.02
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.03
50 0.05
51 0.05
52 0.05
53 0.07
54 0.08
55 0.11
56 0.15
57 0.17
58 0.19
59 0.26
60 0.28
61 0.32
62 0.36
63 0.38
64 0.38
65 0.36
66 0.36
67 0.3
68 0.29
69 0.24
70 0.19
71 0.14
72 0.1
73 0.09
74 0.06
75 0.06
76 0.05
77 0.04
78 0.04
79 0.03
80 0.04
81 0.05