Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GUN2

Protein Details
Accession L2GUN2   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
23-48ESKHDAIKRLKLKKERTSKIKELKEEBasic
NLS Segment(s)
PositionSequence
30-42KRLKLKKERTSKI
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MKSLKTARKFDSAEKRVQPENLESKHDAIKRLKLKKERTSKIKELKEEIHFKTGNEYFFKMNSLRQENDKLVRISKFDMAESKRRVISLNFEIIRMEKKLRKTMPVLKPAKIVFEDCPQGVKVECRQELKPDKERLATYRDYLAKLYKTKQQIEKMIENTKKQRGQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.63
3 0.58
4 0.58
5 0.52
6 0.48
7 0.53
8 0.47
9 0.46
10 0.43
11 0.42
12 0.46
13 0.45
14 0.44
15 0.4
16 0.46
17 0.49
18 0.56
19 0.62
20 0.65
21 0.72
22 0.75
23 0.81
24 0.81
25 0.82
26 0.82
27 0.83
28 0.84
29 0.81
30 0.76
31 0.71
32 0.68
33 0.65
34 0.64
35 0.56
36 0.53
37 0.47
38 0.42
39 0.43
40 0.39
41 0.35
42 0.29
43 0.28
44 0.22
45 0.22
46 0.24
47 0.18
48 0.18
49 0.22
50 0.24
51 0.24
52 0.27
53 0.3
54 0.31
55 0.34
56 0.35
57 0.29
58 0.28
59 0.27
60 0.25
61 0.23
62 0.23
63 0.2
64 0.17
65 0.22
66 0.22
67 0.28
68 0.29
69 0.3
70 0.27
71 0.27
72 0.27
73 0.22
74 0.25
75 0.2
76 0.25
77 0.23
78 0.22
79 0.22
80 0.22
81 0.23
82 0.19
83 0.2
84 0.17
85 0.21
86 0.29
87 0.31
88 0.34
89 0.39
90 0.47
91 0.51
92 0.58
93 0.57
94 0.51
95 0.53
96 0.49
97 0.46
98 0.37
99 0.31
100 0.23
101 0.24
102 0.25
103 0.21
104 0.22
105 0.19
106 0.19
107 0.18
108 0.18
109 0.2
110 0.25
111 0.29
112 0.31
113 0.32
114 0.41
115 0.49
116 0.54
117 0.57
118 0.56
119 0.55
120 0.56
121 0.58
122 0.52
123 0.49
124 0.44
125 0.37
126 0.38
127 0.37
128 0.34
129 0.34
130 0.35
131 0.35
132 0.37
133 0.39
134 0.39
135 0.44
136 0.51
137 0.57
138 0.6
139 0.62
140 0.64
141 0.69
142 0.68
143 0.7
144 0.68
145 0.68
146 0.68
147 0.69