Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GS58

Protein Details
Accession L2GS58    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
95-118KDKSVDVDRNKKRKERWSTINNLVHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 13, golg 7, pero 3, cyto 1, plas 1, extr 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MIAFHRIMLLVLHFVLLLPALLSTDSGTKNDEIGNSLEEAVIKQANDCDTSYFYCNPDEISFNIVLHNRKDEEEGTSVKNEVVSMHDVITNAFNKDKSVDVDRNKKRKERWSTINNLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.05
5 0.04
6 0.03
7 0.04
8 0.04
9 0.04
10 0.05
11 0.09
12 0.1
13 0.1
14 0.13
15 0.13
16 0.14
17 0.14
18 0.14
19 0.13
20 0.13
21 0.13
22 0.11
23 0.11
24 0.1
25 0.09
26 0.09
27 0.08
28 0.08
29 0.07
30 0.07
31 0.08
32 0.09
33 0.1
34 0.11
35 0.11
36 0.11
37 0.13
38 0.16
39 0.15
40 0.15
41 0.14
42 0.14
43 0.14
44 0.13
45 0.13
46 0.1
47 0.12
48 0.11
49 0.11
50 0.12
51 0.14
52 0.15
53 0.14
54 0.16
55 0.15
56 0.15
57 0.17
58 0.16
59 0.16
60 0.17
61 0.19
62 0.18
63 0.18
64 0.17
65 0.16
66 0.15
67 0.12
68 0.1
69 0.1
70 0.11
71 0.11
72 0.11
73 0.12
74 0.12
75 0.13
76 0.16
77 0.15
78 0.14
79 0.15
80 0.15
81 0.15
82 0.16
83 0.18
84 0.18
85 0.24
86 0.31
87 0.38
88 0.49
89 0.58
90 0.67
91 0.72
92 0.76
93 0.77
94 0.8
95 0.82
96 0.81
97 0.81
98 0.81