Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S350

Protein Details
Accession E3S350    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-35AVVHVKQKGRQQQDQKIRQVKDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR045851  AMP-bd_C_sf  
KEGG pte:PTT_16839  -  
Amino Acid Sequences MKATNELSCYRYAAVVHVKQKGRQQQDQKIRQVKDEEWVDFTKRGMDRKSLQQQLSALSSSSIIAVSNIPYSKTIVSRCLVESLDDVAAEKLCDQDWLSSVHKKAQRISSFSATDLVELAQGAGCQVEISWSRQKSQHGGLDAIFHQCTPEKGEDRVLFRFPTDHAERPLHSLSSKPLQQQDLQRTQQQLREMLQDQLPAYMVPQTITVLDAMPLNQNGKVDRNVLAQLVQEPTARQGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.33
3 0.38
4 0.44
5 0.47
6 0.49
7 0.57
8 0.61
9 0.61
10 0.63
11 0.67
12 0.69
13 0.77
14 0.82
15 0.83
16 0.83
17 0.76
18 0.72
19 0.68
20 0.58
21 0.56
22 0.52
23 0.43
24 0.39
25 0.39
26 0.37
27 0.33
28 0.32
29 0.3
30 0.28
31 0.32
32 0.3
33 0.35
34 0.36
35 0.46
36 0.55
37 0.56
38 0.54
39 0.51
40 0.49
41 0.45
42 0.42
43 0.33
44 0.23
45 0.15
46 0.15
47 0.12
48 0.11
49 0.08
50 0.06
51 0.06
52 0.06
53 0.07
54 0.09
55 0.1
56 0.1
57 0.11
58 0.12
59 0.13
60 0.16
61 0.17
62 0.18
63 0.19
64 0.2
65 0.2
66 0.21
67 0.19
68 0.17
69 0.16
70 0.14
71 0.13
72 0.11
73 0.1
74 0.08
75 0.08
76 0.08
77 0.07
78 0.05
79 0.05
80 0.06
81 0.06
82 0.07
83 0.08
84 0.12
85 0.14
86 0.17
87 0.18
88 0.24
89 0.26
90 0.28
91 0.31
92 0.36
93 0.37
94 0.38
95 0.41
96 0.39
97 0.37
98 0.35
99 0.33
100 0.25
101 0.21
102 0.17
103 0.12
104 0.07
105 0.06
106 0.06
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.02
113 0.02
114 0.05
115 0.06
116 0.1
117 0.16
118 0.17
119 0.19
120 0.22
121 0.24
122 0.26
123 0.3
124 0.29
125 0.25
126 0.26
127 0.24
128 0.24
129 0.23
130 0.21
131 0.16
132 0.12
133 0.11
134 0.1
135 0.11
136 0.12
137 0.16
138 0.16
139 0.17
140 0.24
141 0.27
142 0.3
143 0.32
144 0.3
145 0.26
146 0.24
147 0.24
148 0.18
149 0.23
150 0.24
151 0.25
152 0.27
153 0.3
154 0.3
155 0.34
156 0.35
157 0.28
158 0.24
159 0.22
160 0.22
161 0.26
162 0.29
163 0.28
164 0.31
165 0.32
166 0.37
167 0.43
168 0.49
169 0.5
170 0.5
171 0.51
172 0.52
173 0.52
174 0.51
175 0.47
176 0.41
177 0.34
178 0.37
179 0.34
180 0.32
181 0.31
182 0.29
183 0.25
184 0.22
185 0.21
186 0.14
187 0.13
188 0.13
189 0.12
190 0.1
191 0.1
192 0.1
193 0.1
194 0.1
195 0.1
196 0.08
197 0.08
198 0.08
199 0.09
200 0.11
201 0.13
202 0.14
203 0.15
204 0.16
205 0.18
206 0.21
207 0.23
208 0.23
209 0.23
210 0.25
211 0.26
212 0.25
213 0.24
214 0.21
215 0.21
216 0.21
217 0.21
218 0.18
219 0.18