Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GYN6

Protein Details
Accession L2GYN6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
201-220SEDQNAYKRHVKERNKTMQNHydrophilic
NLS Segment(s)
PositionSequence
173-189NGKIKVFLKKGFRLKKP
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039907  NOB1  
IPR036283  NOB1_Zf-like_sf  
IPR014881  NOB1_Zn-bd  
IPR033411  Ribonuclease_PIN  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0004518  F:nuclease activity  
Pfam View protein in Pfam  
PF08772  NOB1_Zn_bind  
PF17146  PIN_6  
Amino Acid Sequences MIAVIDTNIIIQRKLSEYEFEKGFITPAVLVEVRGEDLNNYLDLYTHKIELVQPDELYLEKVYGLQKEKNLLLSKADMEVVALTLQLNESFERERLNGWITRENINERVECLSLDNGVQQCLRLFKRTDGGAVDERNFMFRCVSCFTLFDNKLDFCKRCASHLISRVSVKKENGKIKVFLKKGFRLKKPLLKDKYGNLLRSEDQNAYKRHVKERNKTMQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.23
4 0.27
5 0.32
6 0.32
7 0.31
8 0.29
9 0.26
10 0.25
11 0.19
12 0.16
13 0.11
14 0.1
15 0.12
16 0.11
17 0.11
18 0.11
19 0.11
20 0.11
21 0.11
22 0.11
23 0.08
24 0.1
25 0.11
26 0.1
27 0.1
28 0.08
29 0.09
30 0.1
31 0.15
32 0.14
33 0.14
34 0.13
35 0.14
36 0.16
37 0.2
38 0.22
39 0.19
40 0.17
41 0.17
42 0.18
43 0.17
44 0.17
45 0.12
46 0.09
47 0.07
48 0.1
49 0.11
50 0.15
51 0.18
52 0.19
53 0.21
54 0.25
55 0.25
56 0.29
57 0.3
58 0.26
59 0.24
60 0.23
61 0.22
62 0.19
63 0.18
64 0.12
65 0.1
66 0.09
67 0.07
68 0.06
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.06
77 0.07
78 0.08
79 0.09
80 0.09
81 0.1
82 0.11
83 0.13
84 0.14
85 0.16
86 0.2
87 0.21
88 0.23
89 0.24
90 0.25
91 0.27
92 0.26
93 0.23
94 0.19
95 0.19
96 0.16
97 0.15
98 0.13
99 0.09
100 0.08
101 0.08
102 0.1
103 0.08
104 0.09
105 0.09
106 0.08
107 0.09
108 0.13
109 0.14
110 0.15
111 0.16
112 0.17
113 0.21
114 0.21
115 0.22
116 0.18
117 0.21
118 0.21
119 0.21
120 0.21
121 0.19
122 0.18
123 0.19
124 0.18
125 0.15
126 0.13
127 0.12
128 0.14
129 0.15
130 0.18
131 0.16
132 0.17
133 0.19
134 0.27
135 0.27
136 0.25
137 0.25
138 0.24
139 0.27
140 0.32
141 0.3
142 0.22
143 0.3
144 0.3
145 0.3
146 0.35
147 0.37
148 0.4
149 0.47
150 0.49
151 0.43
152 0.48
153 0.49
154 0.48
155 0.47
156 0.43
157 0.44
158 0.48
159 0.53
160 0.56
161 0.55
162 0.55
163 0.57
164 0.63
165 0.58
166 0.56
167 0.55
168 0.57
169 0.63
170 0.67
171 0.67
172 0.67
173 0.72
174 0.75
175 0.77
176 0.79
177 0.76
178 0.75
179 0.73
180 0.69
181 0.71
182 0.69
183 0.62
184 0.54
185 0.51
186 0.45
187 0.45
188 0.44
189 0.38
190 0.38
191 0.42
192 0.42
193 0.44
194 0.5
195 0.5
196 0.56
197 0.61
198 0.65
199 0.68
200 0.76