Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GX28

Protein Details
Accession L2GX28   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
99-128IEEVRKTNTKKSERKKQRKEKMKREIEERLBasic
NLS Segment(s)
PositionSequence
104-125KTNTKKSERKKQRKEKMKREIE
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MAHDPVTKRIAVLSKGNIKNVKLDGVESLISQNIPENKLTSISFRKKKKLALVIELSDVNSAKIVYDILDGQEIENILLECYFMDEKAELGEEIFTEKIEEVRKTNTKKSERKKQRKEKMKREIEERLNRKNADGFIFDPSDARFGKVYTDPNFFIDASHPLYRNNSGAEMMVEEMKRRNME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.52
4 0.52
5 0.47
6 0.49
7 0.45
8 0.41
9 0.31
10 0.29
11 0.24
12 0.22
13 0.22
14 0.16
15 0.16
16 0.12
17 0.11
18 0.11
19 0.14
20 0.15
21 0.16
22 0.17
23 0.17
24 0.17
25 0.2
26 0.2
27 0.22
28 0.28
29 0.36
30 0.44
31 0.49
32 0.57
33 0.59
34 0.65
35 0.67
36 0.66
37 0.62
38 0.61
39 0.59
40 0.52
41 0.49
42 0.44
43 0.35
44 0.27
45 0.22
46 0.14
47 0.09
48 0.08
49 0.06
50 0.06
51 0.05
52 0.05
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.06
64 0.05
65 0.05
66 0.05
67 0.04
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.06
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.04
83 0.04
84 0.05
85 0.07
86 0.09
87 0.11
88 0.11
89 0.17
90 0.24
91 0.28
92 0.34
93 0.41
94 0.48
95 0.57
96 0.65
97 0.7
98 0.75
99 0.83
100 0.88
101 0.9
102 0.91
103 0.92
104 0.94
105 0.94
106 0.93
107 0.92
108 0.85
109 0.81
110 0.8
111 0.79
112 0.78
113 0.73
114 0.71
115 0.67
116 0.63
117 0.57
118 0.51
119 0.44
120 0.36
121 0.33
122 0.25
123 0.23
124 0.24
125 0.22
126 0.19
127 0.17
128 0.19
129 0.16
130 0.17
131 0.13
132 0.12
133 0.16
134 0.2
135 0.26
136 0.26
137 0.3
138 0.3
139 0.31
140 0.33
141 0.29
142 0.26
143 0.22
144 0.21
145 0.22
146 0.25
147 0.24
148 0.23
149 0.28
150 0.3
151 0.3
152 0.28
153 0.24
154 0.21
155 0.21
156 0.19
157 0.16
158 0.15
159 0.17
160 0.15
161 0.16
162 0.19