Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GSX1

Protein Details
Accession L2GSX1   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-37KESKIAKTSSKEKKKWTTGKTKEETSHydrophilic
NLS Segment(s)
PositionSequence
4-27KAPESKASKESKIAKTSSKEKKKW
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKKAPESKASKESKIAKTSSKEKKKWTTGKTKEETSRHTCVDPELFNKIVKDVANMKVITRSTLAEKYNINLYSSIRILRYLCENEVVGCVSKGRRLNIYCGSKFVRKEVVEDVTKKEDELETWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.62
3 0.59
4 0.56
5 0.57
6 0.64
7 0.67
8 0.68
9 0.67
10 0.7
11 0.77
12 0.8
13 0.83
14 0.82
15 0.82
16 0.81
17 0.85
18 0.81
19 0.79
20 0.77
21 0.72
22 0.7
23 0.65
24 0.61
25 0.52
26 0.47
27 0.4
28 0.34
29 0.33
30 0.28
31 0.23
32 0.22
33 0.21
34 0.21
35 0.21
36 0.19
37 0.17
38 0.15
39 0.15
40 0.15
41 0.17
42 0.2
43 0.2
44 0.2
45 0.21
46 0.21
47 0.19
48 0.16
49 0.14
50 0.13
51 0.17
52 0.17
53 0.16
54 0.16
55 0.16
56 0.21
57 0.2
58 0.18
59 0.15
60 0.15
61 0.16
62 0.16
63 0.17
64 0.12
65 0.13
66 0.13
67 0.13
68 0.17
69 0.17
70 0.17
71 0.17
72 0.17
73 0.16
74 0.17
75 0.16
76 0.12
77 0.09
78 0.11
79 0.1
80 0.15
81 0.18
82 0.2
83 0.26
84 0.28
85 0.34
86 0.41
87 0.49
88 0.45
89 0.46
90 0.49
91 0.47
92 0.46
93 0.44
94 0.43
95 0.35
96 0.38
97 0.38
98 0.41
99 0.41
100 0.42
101 0.44
102 0.41
103 0.4
104 0.37
105 0.34
106 0.28