Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GS94

Protein Details
Accession L2GS94   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-85PPWPFYRRNPFQFKKLKKIDHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 8, E.R. 6, mito 5, golg 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009542  Spc1/SPCS1  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF06645  SPC12  
Amino Acid Sequences MFKNLYKTLTQPIDYYGQDLAKKAAYNILLLGYSLAWIIGYFMSDLRYTFFTGIVTVLVAFVVVVPPWPFYRRNPFQFKKLKKID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.24
4 0.22
5 0.21
6 0.21
7 0.2
8 0.17
9 0.17
10 0.16
11 0.17
12 0.14
13 0.14
14 0.13
15 0.12
16 0.1
17 0.1
18 0.1
19 0.06
20 0.05
21 0.05
22 0.04
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.04
30 0.05
31 0.05
32 0.06
33 0.07
34 0.08
35 0.09
36 0.09
37 0.09
38 0.08
39 0.08
40 0.08
41 0.07
42 0.06
43 0.05
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.05
53 0.07
54 0.1
55 0.13
56 0.15
57 0.22
58 0.33
59 0.41
60 0.5
61 0.59
62 0.62
63 0.7
64 0.78
65 0.8