Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GR42

Protein Details
Accession L2GR42   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
176-203MEVSGVNRKNKSKKNVFRKVKDKLNGWFHydrophilic
NLS Segment(s)
PositionSequence
183-208RKNKSKKNVFRKVKDKLNGWFRKERK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences YVYSEKARIVCLDSVEQMEIPEKKGKLSEVFEYFITSLFYDLLVGEFNGMAVCMSRAGENDVNMSVLISELEYDEANEILKNPSWLVREYKFKNWDIETKSETANSKKELEDKIDTCEDTDEKENMDPTASRENDNNTRREHKTENRKMELGEDTYDAGEEAEIGYETDEYRTVEMEVSGVNRKNKSKKNVFRKVKDKLNGWFRKERKENS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.21
4 0.18
5 0.21
6 0.2
7 0.21
8 0.25
9 0.24
10 0.24
11 0.26
12 0.29
13 0.29
14 0.32
15 0.35
16 0.32
17 0.34
18 0.32
19 0.33
20 0.29
21 0.24
22 0.21
23 0.14
24 0.11
25 0.09
26 0.09
27 0.07
28 0.07
29 0.06
30 0.06
31 0.05
32 0.05
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.06
44 0.11
45 0.13
46 0.13
47 0.14
48 0.14
49 0.14
50 0.13
51 0.12
52 0.07
53 0.06
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.06
66 0.07
67 0.07
68 0.08
69 0.08
70 0.11
71 0.12
72 0.14
73 0.18
74 0.2
75 0.28
76 0.31
77 0.38
78 0.4
79 0.4
80 0.42
81 0.4
82 0.43
83 0.38
84 0.38
85 0.33
86 0.29
87 0.28
88 0.26
89 0.26
90 0.22
91 0.21
92 0.2
93 0.2
94 0.19
95 0.23
96 0.22
97 0.25
98 0.26
99 0.24
100 0.26
101 0.25
102 0.24
103 0.2
104 0.2
105 0.16
106 0.14
107 0.15
108 0.12
109 0.12
110 0.13
111 0.13
112 0.11
113 0.12
114 0.1
115 0.11
116 0.19
117 0.19
118 0.19
119 0.2
120 0.26
121 0.34
122 0.38
123 0.39
124 0.35
125 0.41
126 0.43
127 0.47
128 0.49
129 0.49
130 0.56
131 0.62
132 0.67
133 0.65
134 0.64
135 0.58
136 0.54
137 0.48
138 0.39
139 0.3
140 0.22
141 0.18
142 0.16
143 0.16
144 0.13
145 0.09
146 0.06
147 0.05
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.05
154 0.05
155 0.06
156 0.07
157 0.08
158 0.08
159 0.09
160 0.09
161 0.09
162 0.09
163 0.09
164 0.08
165 0.11
166 0.16
167 0.2
168 0.25
169 0.3
170 0.38
171 0.48
172 0.56
173 0.64
174 0.69
175 0.75
176 0.81
177 0.87
178 0.89
179 0.9
180 0.91
181 0.9
182 0.88
183 0.86
184 0.81
185 0.79
186 0.8
187 0.78
188 0.76
189 0.77
190 0.72
191 0.75