Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A024RE55

Protein Details
Accession A0A024RE55    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-28QITRTVLKLKKPRTRTRTLRLVRRRVTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito_nucl 13.333, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MQITRTVLKLKKPRTRTRTLRLVRRRVTFTPDTVDNEHMGKKKSKCCCIYKTGNDKTKNKYER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.83
3 0.83
4 0.82
5 0.83
6 0.82
7 0.83
8 0.82
9 0.83
10 0.79
11 0.75
12 0.72
13 0.63
14 0.62
15 0.53
16 0.44
17 0.38
18 0.33
19 0.31
20 0.27
21 0.27
22 0.21
23 0.2
24 0.22
25 0.21
26 0.22
27 0.26
28 0.3
29 0.37
30 0.44
31 0.52
32 0.56
33 0.61
34 0.64
35 0.66
36 0.7
37 0.73
38 0.75
39 0.76
40 0.77
41 0.79
42 0.79
43 0.78