Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8G4G7

Protein Details
Accession L8G4G7   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
33-64EKLSTKHQFRLERRYRRRSKLKWARPKWTKAVHydrophilic
NLS Segment(s)
PositionSequence
43-62LERRYRRRSKLKWARPKWTK
Subcellular Location(s) mito 11, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MFRTPVLRALEKGPTYIDTNVYRAKRLWPPDFEKLSTKHQFRLERRYRRRSKLKWARPKWTKAVKIAQLGSIVFVTVYGVLFADWKQENEPFQGLRNKFRELTGSIWTTKPERGQRREGAEGAGSKPNVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.27
4 0.29
5 0.23
6 0.26
7 0.32
8 0.31
9 0.31
10 0.29
11 0.34
12 0.36
13 0.42
14 0.45
15 0.45
16 0.51
17 0.58
18 0.61
19 0.57
20 0.55
21 0.5
22 0.53
23 0.54
24 0.49
25 0.45
26 0.49
27 0.55
28 0.56
29 0.63
30 0.64
31 0.67
32 0.75
33 0.8
34 0.82
35 0.83
36 0.88
37 0.84
38 0.85
39 0.85
40 0.86
41 0.86
42 0.84
43 0.85
44 0.82
45 0.81
46 0.79
47 0.77
48 0.7
49 0.65
50 0.64
51 0.57
52 0.53
53 0.48
54 0.4
55 0.32
56 0.27
57 0.22
58 0.15
59 0.1
60 0.06
61 0.05
62 0.04
63 0.04
64 0.04
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.08
71 0.09
72 0.1
73 0.11
74 0.14
75 0.15
76 0.17
77 0.2
78 0.16
79 0.2
80 0.28
81 0.29
82 0.35
83 0.37
84 0.38
85 0.37
86 0.37
87 0.36
88 0.31
89 0.32
90 0.29
91 0.29
92 0.27
93 0.27
94 0.29
95 0.27
96 0.28
97 0.32
98 0.37
99 0.44
100 0.49
101 0.57
102 0.61
103 0.66
104 0.68
105 0.61
106 0.54
107 0.48
108 0.44
109 0.39
110 0.38