Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8FPM5

Protein Details
Accession L8FPM5    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
154-174KEGAAPVTKKSKKKTKEDGEEBasic
NLS Segment(s)
PositionSequence
162-168KKSKKKT
Subcellular Location(s) cyto 15.5, cyto_nucl 12.833, nucl 9, mito_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR046522  DUF6699  
Pfam View protein in Pfam  
PF20415  DUF6699  
Amino Acid Sequences MADIDNVPLTKVDSAVQGLSSSPPKEKGHRRMSSTAAGVFNINDLEKEGTELLIAKETQKLNWRINKSPTTVEDKDYLKKFLTTPPVKKIDLHFPLGLEVTARNLKGVTIKDALDAIYKQFRKKADDELEAPVLAGFEWDKEESWTRLIVHCKKEGAAPVTKKSKKKTKEDGEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.12
5 0.12
6 0.15
7 0.18
8 0.18
9 0.19
10 0.25
11 0.28
12 0.37
13 0.47
14 0.54
15 0.6
16 0.65
17 0.69
18 0.68
19 0.69
20 0.64
21 0.57
22 0.5
23 0.4
24 0.34
25 0.27
26 0.22
27 0.18
28 0.14
29 0.11
30 0.07
31 0.08
32 0.09
33 0.08
34 0.1
35 0.09
36 0.08
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.09
43 0.14
44 0.14
45 0.16
46 0.23
47 0.28
48 0.33
49 0.4
50 0.45
51 0.45
52 0.52
53 0.53
54 0.48
55 0.46
56 0.42
57 0.43
58 0.39
59 0.36
60 0.33
61 0.32
62 0.35
63 0.33
64 0.32
65 0.24
66 0.24
67 0.23
68 0.23
69 0.31
70 0.31
71 0.34
72 0.39
73 0.42
74 0.42
75 0.42
76 0.4
77 0.4
78 0.36
79 0.35
80 0.29
81 0.24
82 0.25
83 0.23
84 0.2
85 0.11
86 0.08
87 0.08
88 0.09
89 0.09
90 0.08
91 0.08
92 0.09
93 0.12
94 0.13
95 0.14
96 0.15
97 0.15
98 0.15
99 0.16
100 0.16
101 0.13
102 0.13
103 0.11
104 0.17
105 0.19
106 0.21
107 0.24
108 0.27
109 0.3
110 0.33
111 0.4
112 0.39
113 0.42
114 0.43
115 0.43
116 0.42
117 0.36
118 0.34
119 0.24
120 0.17
121 0.12
122 0.1
123 0.06
124 0.05
125 0.07
126 0.08
127 0.08
128 0.11
129 0.15
130 0.16
131 0.18
132 0.2
133 0.19
134 0.23
135 0.32
136 0.37
137 0.39
138 0.41
139 0.41
140 0.4
141 0.42
142 0.44
143 0.4
144 0.42
145 0.42
146 0.46
147 0.56
148 0.62
149 0.66
150 0.69
151 0.74
152 0.75
153 0.8
154 0.82