Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8FLM9

Protein Details
Accession L8FLM9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MADRRSDRRRHKMIPRSTKAERVBasic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR046676  DUF6546  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF20183  DUF6546  
PF12937  F-box-like  
Amino Acid Sequences MADRRSDRRRHKMIPRSTKAERVYWLSLPAEVRLMILDIFTRQKSPGWASCAAVCKEWQFFIEKRNFHRLKLQGSCLDEFNRMVIRQRDLVHHIQLDIKLPEYSYQSCEKAETHLWESRKCSIIRDAIRTLFSILGTWDPASDLTLELKAHSPSDSKHWFKNHGFAPNDDGAGAASSRQDGYGGETSSAGLWRLERLVYEPLRSPWKSRQAVSDDDTLFLAQLLLSKAHNPPKSLSVFEDFNAEFAAAFIYRLRRDCASITWRGTWSLEISPEVIEAWRSVASELHSVQLRVEKQQVHEEIGSHGDAIHYLDLPCRVVESASLWQIRRENAEGMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.85
4 0.81
5 0.8
6 0.73
7 0.68
8 0.61
9 0.57
10 0.53
11 0.46
12 0.45
13 0.37
14 0.36
15 0.32
16 0.28
17 0.23
18 0.18
19 0.16
20 0.13
21 0.13
22 0.09
23 0.09
24 0.08
25 0.1
26 0.14
27 0.14
28 0.16
29 0.16
30 0.18
31 0.23
32 0.29
33 0.31
34 0.33
35 0.35
36 0.35
37 0.38
38 0.43
39 0.39
40 0.34
41 0.3
42 0.27
43 0.27
44 0.26
45 0.22
46 0.21
47 0.21
48 0.29
49 0.36
50 0.38
51 0.42
52 0.52
53 0.53
54 0.49
55 0.56
56 0.53
57 0.54
58 0.55
59 0.54
60 0.48
61 0.51
62 0.5
63 0.44
64 0.4
65 0.33
66 0.27
67 0.24
68 0.21
69 0.18
70 0.22
71 0.24
72 0.24
73 0.27
74 0.29
75 0.31
76 0.34
77 0.37
78 0.35
79 0.32
80 0.3
81 0.28
82 0.27
83 0.27
84 0.21
85 0.19
86 0.15
87 0.15
88 0.16
89 0.17
90 0.17
91 0.17
92 0.2
93 0.2
94 0.21
95 0.22
96 0.2
97 0.2
98 0.22
99 0.23
100 0.23
101 0.27
102 0.29
103 0.3
104 0.33
105 0.33
106 0.35
107 0.32
108 0.3
109 0.3
110 0.36
111 0.37
112 0.39
113 0.38
114 0.35
115 0.35
116 0.33
117 0.29
118 0.21
119 0.17
120 0.12
121 0.09
122 0.08
123 0.08
124 0.07
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.07
133 0.07
134 0.08
135 0.09
136 0.09
137 0.1
138 0.1
139 0.1
140 0.1
141 0.17
142 0.24
143 0.25
144 0.29
145 0.32
146 0.38
147 0.38
148 0.44
149 0.4
150 0.4
151 0.39
152 0.35
153 0.36
154 0.3
155 0.29
156 0.22
157 0.18
158 0.11
159 0.1
160 0.09
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.08
169 0.11
170 0.11
171 0.11
172 0.11
173 0.11
174 0.11
175 0.12
176 0.08
177 0.05
178 0.05
179 0.06
180 0.06
181 0.06
182 0.06
183 0.08
184 0.14
185 0.15
186 0.17
187 0.18
188 0.2
189 0.27
190 0.28
191 0.29
192 0.31
193 0.4
194 0.42
195 0.41
196 0.45
197 0.43
198 0.46
199 0.45
200 0.44
201 0.34
202 0.31
203 0.3
204 0.23
205 0.19
206 0.14
207 0.11
208 0.04
209 0.06
210 0.06
211 0.07
212 0.07
213 0.1
214 0.15
215 0.23
216 0.25
217 0.25
218 0.27
219 0.32
220 0.34
221 0.33
222 0.31
223 0.27
224 0.26
225 0.24
226 0.27
227 0.21
228 0.19
229 0.17
230 0.14
231 0.1
232 0.09
233 0.1
234 0.05
235 0.06
236 0.07
237 0.11
238 0.14
239 0.16
240 0.19
241 0.19
242 0.21
243 0.23
244 0.28
245 0.29
246 0.34
247 0.35
248 0.36
249 0.36
250 0.35
251 0.33
252 0.28
253 0.25
254 0.21
255 0.19
256 0.16
257 0.16
258 0.15
259 0.14
260 0.13
261 0.11
262 0.09
263 0.08
264 0.09
265 0.09
266 0.09
267 0.09
268 0.11
269 0.12
270 0.16
271 0.16
272 0.19
273 0.19
274 0.19
275 0.2
276 0.25
277 0.25
278 0.24
279 0.3
280 0.29
281 0.31
282 0.4
283 0.4
284 0.38
285 0.38
286 0.35
287 0.31
288 0.3
289 0.27
290 0.18
291 0.16
292 0.11
293 0.11
294 0.11
295 0.11
296 0.09
297 0.1
298 0.12
299 0.14
300 0.15
301 0.14
302 0.14
303 0.14
304 0.12
305 0.13
306 0.15
307 0.19
308 0.25
309 0.3
310 0.29
311 0.33
312 0.37
313 0.39
314 0.4
315 0.38