Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8FVB8

Protein Details
Accession L8FVB8    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
47-69YELTSQKRKKLKRLPLHAKNSSLHydrophilic
NLS Segment(s)
PositionSequence
54-59RKKLKR
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MESEHIERSRIQKLSGPNYRNWALQIQIELIDRKVWSTIDDKFTLEYELTSQKRKKLKRLPLHAKNSSLYSATTGLGGSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.51
4 0.46
5 0.51
6 0.51
7 0.47
8 0.41
9 0.33
10 0.25
11 0.23
12 0.21
13 0.15
14 0.15
15 0.15
16 0.14
17 0.12
18 0.12
19 0.11
20 0.1
21 0.1
22 0.09
23 0.09
24 0.11
25 0.14
26 0.16
27 0.17
28 0.17
29 0.17
30 0.17
31 0.16
32 0.13
33 0.1
34 0.09
35 0.16
36 0.17
37 0.24
38 0.26
39 0.32
40 0.4
41 0.46
42 0.55
43 0.58
44 0.67
45 0.7
46 0.79
47 0.84
48 0.86
49 0.9
50 0.84
51 0.78
52 0.69
53 0.61
54 0.52
55 0.42
56 0.32
57 0.25
58 0.21
59 0.18
60 0.16